BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20798 (718 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 5.0 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 5.0 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 6.7 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 5.0 Identities = 16/52 (30%), Positives = 24/52 (46%) Frame = +1 Query: 316 LNIFYLLQLRTAM*HRT*FDHTLYTISITMNFNLEYHIYGVFISLVCLLL*N 471 L I L + + R F+ + +I ++ N I GVF S+ LLL N Sbjct: 504 LQILNLARNKVQHVERYAFERNMRLEAIRLDGNFLSDINGVFTSIASLLLLN 555 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 640 FIILCDIYFIRDNDEVTD 587 FIILC+ +RDN + D Sbjct: 502 FIILCEAPALRDNTKPID 519 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 323 YFIYYNFVLRCNIELSSTIP 382 YFIY+ R +EL+ IP Sbjct: 26 YFIYFRISRRHLLELAEKIP 45 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,942 Number of Sequences: 438 Number of extensions: 4306 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -