BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20796 (588 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 26 0.21 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 25 0.63 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 24 0.83 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 24 0.83 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 24 0.83 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 24 0.83 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 24 0.83 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 24 0.83 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 24 0.83 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 24 0.83 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 24 0.83 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 4.4 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 5.8 EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 pr... 21 7.7 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 21 7.7 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 26.2 bits (55), Expect = 0.21 Identities = 22/88 (25%), Positives = 37/88 (42%) Frame = +1 Query: 43 PIPAACGLYYFEVRIVSKGRDGYMGIGLSAHGVNMNRLPGWDKHSYGYHGDDGHSFCSSG 222 P P C YY V + + R Y GL H ++ W K + GH +S Sbjct: 1110 PDPHNCNAYYRCV--LGELRKQYCAGGL--HWNKERKICDWPKSAKCEEKKPGHKPSTSS 1165 Query: 223 TGQPYGPTFTTETSSDVESTWSTTRAST 306 +P P++ ++++ T +TT +T Sbjct: 1166 WQKPTKPSYRPPSTTNHWQTKTTTSTTT 1193 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 24.6 bits (51), Expect = 0.63 Identities = 18/65 (27%), Positives = 26/65 (40%) Frame = -2 Query: 575 CCSTRGAPGTSTPSCATPGATVLLVGQRELIDGDPGPSAQLLQHVLDVENERLLTEVRVH 396 C ST+ P + P A Q EL P P+ LL+H N +++ V+ Sbjct: 86 CGSTQLWPQPTGPVTLASRAVTFNHQQLELETDTPEPARTLLEHSFVAFNTNIISLVQNK 145 Query: 395 DLAGR 381 D R Sbjct: 146 DYVER 150 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 0.83 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 569 STRGAPGTSTPSCATP 522 ST GAP STP +TP Sbjct: 117 STNGAPPRSTPPLSTP 132 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 0.83 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 569 STRGAPGTSTPSCATP 522 ST GAP STP +TP Sbjct: 117 STNGAPPRSTPPLSTP 132 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 24.2 bits (50), Expect = 0.83 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 569 STRGAPGTSTPSCATP 522 ST GAP STP +TP Sbjct: 117 STNGAPPRSTPPLSTP 132 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 0.83 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 569 STRGAPGTSTPSCATP 522 ST GAP STP +TP Sbjct: 117 STNGAPPRSTPPLSTP 132 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 24.2 bits (50), Expect = 0.83 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 569 STRGAPGTSTPSCATP 522 ST GAP STP +TP Sbjct: 117 STNGAPPRSTPPLSTP 132 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 24.2 bits (50), Expect = 0.83 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 569 STRGAPGTSTPSCATP 522 ST GAP STP +TP Sbjct: 73 STNGAPPRSTPPLSTP 88 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 24.2 bits (50), Expect = 0.83 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 569 STRGAPGTSTPSCATP 522 ST GAP STP +TP Sbjct: 117 STNGAPPRSTPPLSTP 132 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 24.2 bits (50), Expect = 0.83 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 569 STRGAPGTSTPSCATP 522 ST GAP STP +TP Sbjct: 117 STNGAPPRSTPPLSTP 132 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 24.2 bits (50), Expect = 0.83 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 569 STRGAPGTSTPSCATP 522 ST GAP STP +TP Sbjct: 117 STNGAPPRSTPPLSTP 132 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 4.4 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +1 Query: 157 PGWDKHSYGYHGDDGHSFCSSGTGQPYGP 243 PG H Y + S SSG+ PY P Sbjct: 121 PGPPSHPYTVISNGYSSPMSSGSYDPYSP 149 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = -3 Query: 244 WVRRAARYRKNKTNGRRLRGSRRNAC 167 W RR R N + L+G+R C Sbjct: 22 WFRRGLRLHDNPSLREGLKGARTFRC 47 >EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 protein. Length = 237 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/23 (30%), Positives = 10/23 (43%) Frame = -1 Query: 441 PRCRKRTAADRSSCPRPRRASEA 373 P C+ A +CP P S + Sbjct: 144 PECKNEEVAGGFTCPAPGEVSNS 166 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/23 (30%), Positives = 10/23 (43%) Frame = -1 Query: 441 PRCRKRTAADRSSCPRPRRASEA 373 P C+ A +CP P S + Sbjct: 144 PECKNEEVAGGFTCPAPGEVSNS 166 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,301 Number of Sequences: 336 Number of extensions: 3130 Number of successful extensions: 15 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14726181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -