BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20795 (766 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK124538-1|BAC85878.1| 256|Homo sapiens protein ( Homo sapiens ... 32 2.6 >AK124538-1|BAC85878.1| 256|Homo sapiens protein ( Homo sapiens cDNA FLJ42547 fis, clone BRACE3004880. ). Length = 256 Score = 31.9 bits (69), Expect = 2.6 Identities = 21/62 (33%), Positives = 38/62 (61%), Gaps = 3/62 (4%) Frame = -2 Query: 234 LISSTITLTGMSTTSFLFARRLLSMSLIVLAWS---MSSCSLDKFSTTFKGLSSASGTLS 64 L S T++ G+S+T+ LFA RL S+++ + S +S+C L + + + GLSS + + Sbjct: 118 LSSMTLSACGLSSTT-LFACRLSSVTVSTCSLSSVTLSACGLSRVTLSACGLSSMTPSAC 176 Query: 63 GM 58 G+ Sbjct: 177 GL 178 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,527,864 Number of Sequences: 237096 Number of extensions: 1701914 Number of successful extensions: 4945 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4939 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9199990470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -