BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= wdS20795
(766 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK124538-1|BAC85878.1| 256|Homo sapiens protein ( Homo sapiens ... 32 2.6
>AK124538-1|BAC85878.1| 256|Homo sapiens protein ( Homo sapiens
cDNA FLJ42547 fis, clone BRACE3004880. ).
Length = 256
Score = 31.9 bits (69), Expect = 2.6
Identities = 21/62 (33%), Positives = 38/62 (61%), Gaps = 3/62 (4%)
Frame = -2
Query: 234 LISSTITLTGMSTTSFLFARRLLSMSLIVLAWS---MSSCSLDKFSTTFKGLSSASGTLS 64
L S T++ G+S+T+ LFA RL S+++ + S +S+C L + + + GLSS + +
Sbjct: 118 LSSMTLSACGLSSTT-LFACRLSSVTVSTCSLSSVTLSACGLSRVTLSACGLSSMTPSAC 176
Query: 63 GM 58
G+
Sbjct: 177 GL 178
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 89,527,864
Number of Sequences: 237096
Number of extensions: 1701914
Number of successful extensions: 4945
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 4594
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4939
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9199990470
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -