BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20795 (766 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 27 0.25 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 27 0.25 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 27 0.25 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 24 1.8 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 4.1 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 4.1 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 5.4 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 7.2 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 9.5 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 26.6 bits (56), Expect = 0.25 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -2 Query: 141 WSMSSCSLDKFSTTFKGLSSASGTLSGMELRV 46 W+M+ + D+++ KGLS +++G +R+ Sbjct: 141 WTMTMIAFDRYNVIVKGLSGKPLSINGALIRI 172 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 26.6 bits (56), Expect = 0.25 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -2 Query: 141 WSMSSCSLDKFSTTFKGLSSASGTLSGMELRV 46 W+M+ + D+++ KGLS +++G +R+ Sbjct: 107 WTMTMIAFDRYNVIVKGLSGKPLSINGALIRI 138 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 26.6 bits (56), Expect = 0.25 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -2 Query: 141 WSMSSCSLDKFSTTFKGLSSASGTLSGMELRV 46 W+M+ + D+++ KGLS +++G +R+ Sbjct: 17 WTMTMIAFDRYNVIVKGLSGKPLSINGALIRI 48 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 83 EDKPLNVVENLSSEQELIDQANTIKDIDNSL 175 E P+ ++ENL + E ID+ ++ S+ Sbjct: 333 ETMPMELIENLRNHPEYIDETRNYQECKCSI 363 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +3 Query: 519 HFQENFGAQIQKLNETLHFIKPADTIAAPSVEETQNKAS 635 H + G LN++LHF++ + + SV E ++++ Sbjct: 20 HILDTCGRDTYALNQSLHFVRASLSNLDMSVLECADRSA 58 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +3 Query: 519 HFQENFGAQIQKLNETLHFIKPADTIAAPSVEETQNKAS 635 H + G LN++LHF++ + + SV E ++++ Sbjct: 110 HILDTCGRDTYALNQSLHFVRASLSNLDMSVLECADRSA 148 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 685 AVLISYLKVFKLWLRSKPTERL 750 AV + L + LWL S+ TER+ Sbjct: 263 AVTMMLLTLTVLWLDSRSTERM 284 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 7.2 Identities = 6/25 (24%), Positives = 15/25 (60%) Frame = +1 Query: 676 ISIAVLISYLKVFKLWLRSKPTERL 750 +++ +++ + + LWL TER+ Sbjct: 251 VTLTIVLMTMTLMTLWLEPSSTERM 275 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/39 (20%), Positives = 23/39 (58%) Frame = +2 Query: 395 PSKMTLTQRKSLFVKASRKCQTVLENGTLVPSKLTSSRQ 511 P + + R++L + ++C+ +LE+ + + L +S++ Sbjct: 451 PLDLAIPVRETLILPPRKRCKMILESMEIERNGLIASQR 489 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,969 Number of Sequences: 438 Number of extensions: 3374 Number of successful extensions: 15 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -