BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20793 (693 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041) 84 1e-16 SB_21942| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.053) 38 0.010 SB_34369| Best HMM Match : Herpes_US9 (HMM E-Value=0.64) 33 0.22 SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_4321| Best HMM Match : Ank (HMM E-Value=0) 29 3.6 SB_7933| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.4e-18) 29 4.7 SB_33920| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_6123| Best HMM Match : MutS_III (HMM E-Value=1.8e-09) 28 6.2 SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) 28 8.3 SB_14136| Best HMM Match : Exonuc_X-T (HMM E-Value=6e-25) 28 8.3 >SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041) Length = 50 Score = 83.8 bits (198), Expect = 1e-16 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = +3 Query: 354 MRGAFGKPQGTVARVRIGQPIMSVRSSDRWKAQVIEALRRAKFKFPGRQK 503 MRGAFGKPQGTVARV IGQ I+S+R+ D KA IEALRRAKFKFPGRQK Sbjct: 1 MRGAFGKPQGTVARVNIGQTIISIRTKDGNKAAAIEALRRAKFKFPGRQK 50 >SB_21942| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.053) Length = 659 Score = 37.5 bits (83), Expect = 0.010 Identities = 27/81 (33%), Positives = 38/81 (46%) Frame = -2 Query: 632 RREVHVPGGTARCSRHWRGGPLHAASQTHHVHTL*NPTSLILDLLTSGELELGTAQSLDD 453 +R++HV G + + H GG L Q H + NP++ L+ LE TA + Sbjct: 10 KRQLHVRGLSRKWVMH-PGGRLPVKRQLHLISAPVNPSTRFTPTLSRMSLETVTAAPIPT 68 Query: 452 LCLPPVTRAHGHDGLSNANTC 390 V A+ DGLSNAN C Sbjct: 69 QTSRSVALAY--DGLSNANVC 87 >SB_34369| Best HMM Match : Herpes_US9 (HMM E-Value=0.64) Length = 361 Score = 33.1 bits (72), Expect = 0.22 Identities = 37/164 (22%), Positives = 68/164 (41%), Gaps = 1/164 (0%) Frame = -2 Query: 629 REVHVPGGTARCSRHWRGGPLHAASQTHHVHTL*NPTSLILDLLTSGELELGTAQSLDDL 450 R H+P G +H P+HA S + N +++ +LT GE L + + Sbjct: 15 RLFHLPSGNRLLVQHPPAFPIHAQSYLTRRRAVFNTMAVLHTVLTKGEQTLFFERPIRRP 74 Query: 449 CLPPVTRAHGHDGLSNANTCYSTLRLAKRTTHPSLEPISSSAR*HFIDADNVERVKSHAD 270 + + S N+ Y+ R + TT +L PI++ H A+++ + A+ Sbjct: 75 RFVALRQC------SLFNSWYNLEREHQITTIAALPPIATLPAGH-QTAESIVETINRAE 127 Query: 269 MELILPQFFTRYLLQQIR-PASKASELSCSYSSDTKCTHSGKSS 141 E++ + R Q+ P +A + C T+C G+ S Sbjct: 128 SEILTAKLDPREDRAQVALPKIEALYICCDIVDRTQCLSLGEPS 171 >SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -3 Query: 208 PKPLSSAVHIRRTPSARTVESRQRSLSSYPNRRYGSWDQ 92 PK SS V+ RT AR ++R++ Y ++YG W Q Sbjct: 295 PKFFSSIVYYGRT--ARFDYGKRRNMKRYGKKKYGKWRQ 331 >SB_4321| Best HMM Match : Ank (HMM E-Value=0) Length = 915 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = +1 Query: 40 RYCKNKPYPKSRFCRGVPDPKIRIFDLGKKRANVDDFPLCVHLVSDEYEQLSSEALEAGR 219 R CK K ++R C+G + R+ K D+ +C SDE E + R Sbjct: 444 RMCKGKGRDETRMCKGEGTDETRMC----KSEGTDETRMCKDEGSDETRMCKDEGTDETR 499 Query: 220 IC 225 +C Sbjct: 500 MC 501 >SB_7933| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.4e-18) Length = 1023 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/47 (34%), Positives = 19/47 (40%) Frame = -1 Query: 405 QCEHVLQYPEACQTHHASQSGAYQLQRTITFY*CG*RGKGEVSCGYG 265 +C V Q P AC + S GA + Y C K V CG G Sbjct: 535 KCPDVTQAPVACTNGYYSGDGATECTLCPAGYSCADATKSPVPCGKG 581 >SB_33920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1278 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -2 Query: 497 TSGELELGTAQSLDDLCLPPVTRAHGHDGLSNANT--CYSTLRLAKRTT 357 ++G + T D+C+P + HGH +ANT CY + A +T Sbjct: 73 SAGHYVVRTGNPFTDICIP--CQCHGHSDQCDANTGICYVRIYTADLST 119 >SB_6123| Best HMM Match : MutS_III (HMM E-Value=1.8e-09) Length = 730 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -2 Query: 311 IDADNVERVKSHADMELILPQFFTRYLLQQIRPASKASELSCSYSSDTK 165 + A+ V+R+ SH M+ + + Y +PA+K + L C Y+ K Sbjct: 16 LTAERVQRLLSHTRMKEV-SRICKVYFSSDTKPAAKTNNLLCQYNEIKK 63 >SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) Length = 726 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 362 CVWQASGYCSTCSHWTTHHV 421 C W +G C C HW HV Sbjct: 79 CYWIRTGCCHLCWHWRPLHV 98 >SB_14136| Best HMM Match : Exonuc_X-T (HMM E-Value=6e-25) Length = 1597 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/43 (30%), Positives = 25/43 (58%) Frame = -1 Query: 180 FVGHQVHAQWKVVNVRSLLTQIEDTDLGIRYTPTEPRFRIRFI 52 FVGH + ++V+N+ Q+ DT +G+ + P + +RF+ Sbjct: 465 FVGHGLKKDFRVINILVPKGQVFDT-VGLFHLPRQRYLSLRFL 506 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,432,541 Number of Sequences: 59808 Number of extensions: 551016 Number of successful extensions: 1904 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1902 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -