BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20789 (741 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92777-2|CAB07167.1| 387|Caenorhabditis elegans Hypothetical pr... 28 6.0 Z70212-4|CAA94164.1| 322|Caenorhabditis elegans Hypothetical pr... 28 6.0 >Z92777-2|CAB07167.1| 387|Caenorhabditis elegans Hypothetical protein C17H1.3 protein. Length = 387 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +3 Query: 444 IRDQQEHLARLHFRLCADVDKPQKIILKI 530 +RD ++ +A+LH A++DK K +LK+ Sbjct: 139 VRDVEDQMAKLHLERGAELDKHHKKMLKM 167 >Z70212-4|CAA94164.1| 322|Caenorhabditis elegans Hypothetical protein R04D3.6 protein. Length = 322 Score = 28.3 bits (60), Expect = 6.0 Identities = 20/78 (25%), Positives = 39/78 (50%), Gaps = 1/78 (1%) Frame = -2 Query: 347 LNIWGFFWYVLGSIGIVRAHKIS-LKTSFIYVDTFVDSFRLLPVLVSTFS*FFDVKLAVR 171 L I+G F+ + V+ K LKT F + F SF L+ ++V T + ++ + +R Sbjct: 107 LTIYGTFFLKYRMVKGVQMSKFEILKTYFTFYCPFCLSFILVIIIVKTQTFSWEAQEQLR 166 Query: 170 LISYYS*QAKSHFVVSFV 117 L++ + + V +F+ Sbjct: 167 LVNLFLNNEDEYLVFAFL 184 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,237,718 Number of Sequences: 27780 Number of extensions: 348177 Number of successful extensions: 1111 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1111 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -