BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20786 (675 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 5.3 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 22 5.3 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/24 (45%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +3 Query: 126 KGK-AKFDAWHKLAGTSKEDAQKA 194 +GK AK W K+AG +ED + A Sbjct: 460 RGKNAKDVDWQKIAGAVEEDDEDA 483 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = -2 Query: 578 RSLTKINTKRNDLVRVYF*NMISKGRKLFHCCSISCFST 462 + + KI R+D V+VY ++ +F S++C+ T Sbjct: 112 QQIDKIFKTRDDRVKVYQAPVLQLFLYIFTYLSVTCYVT 150 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,341 Number of Sequences: 336 Number of extensions: 3254 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -