BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20786 (675 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3091| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_42415| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 >SB_3091| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 52.4 bits (120), Expect = 3e-07 Identities = 28/65 (43%), Positives = 39/65 (60%) Frame = +3 Query: 9 VKNLKALPTDAQLLNLYAHFKQATVGDADPANRPGLLDLKGKAKFDAWHKLAGTSKEDAQ 188 V++LK L D Q L Y FKQAT G +RPG D+ GKAK+++WH+ +E A Sbjct: 24 VRSLKNL-RDEQKLLFYGLFKQATEGPCK-TSRPGFWDIVGKAKWESWHQHGKMPQEKAM 81 Query: 189 KAYIE 203 K Y++ Sbjct: 82 KIYVQ 86 >SB_42415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -2 Query: 539 VRVYF*NMISKGRKLFHCCSI-SCFSTLEVPFINVR 435 +R YF I +G+K+ CC + +C T E PF V+ Sbjct: 311 LREYFIKEIERGKKVIRCCCVPNCVDTFE-PFYVVK 345 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,923,769 Number of Sequences: 59808 Number of extensions: 351267 Number of successful extensions: 719 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -