BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20782 (590 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 30 0.017 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 24 1.1 AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-... 22 4.5 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 21 5.9 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 7.8 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 29.9 bits (64), Expect = 0.017 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -1 Query: 530 VIKCVNQRFEKGSFFWNTPFKLEGNKYKLLFTY 432 ++K V+ R +KG FW +PF + + + TY Sbjct: 381 ILKTVSNRNDKGDIFWFSPFLVANLAFVTIVTY 413 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 23.8 bits (49), Expect = 1.1 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 300 LKNVILCPYGFNPSAE*LVASRR 232 ++ +LCP NP E LV+++R Sbjct: 7 IRKFVLCPECENPETELLVSTKR 29 >AY600515-1|AAT11863.1| 134|Tribolium castaneum optomotor-blind-like protein protein. Length = 134 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/20 (35%), Positives = 11/20 (55%) Frame = +3 Query: 45 NNIKESRRVLLIKLIHKYNP 104 NNI + ++ +HKY P Sbjct: 81 NNISDKHGFTILNSMHKYQP 100 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 21.4 bits (43), Expect = 5.9 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 384 MLAKAQILYHIQCIKPGNSFGPYS 313 +L+ + L+H +C KP + P S Sbjct: 25 VLSSDEELFHQKCPKPAPIYSPVS 48 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 7.8 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +3 Query: 72 LLIKLIHKYNPTV 110 +++ +HKY PTV Sbjct: 144 IMLNSLHKYKPTV 156 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,109 Number of Sequences: 336 Number of extensions: 2512 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14830622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -