BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20780 (416 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44068| Best HMM Match : SAA (HMM E-Value=0.73) 27 6.2 SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) 27 6.2 SB_24118| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_44068| Best HMM Match : SAA (HMM E-Value=0.73) Length = 209 Score = 27.1 bits (57), Expect = 6.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -2 Query: 178 CQGQSQPIPYRLPKYMCHNKWNRFNEINHNL 86 C S+P Y L HN+W R NE+ +L Sbjct: 94 CDMTSEPGAYTLLVTSRHNQWTRHNEMRPSL 124 >SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) Length = 3810 Score = 27.1 bits (57), Expect = 6.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 279 KCLDCLASYGCYGIGR*NRYILC 347 +C DCLA Y C G G N +C Sbjct: 194 QCTDCLAGYYCQGTGLKNFSDVC 216 >SB_24118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1067 Score = 26.6 bits (56), Expect = 8.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 201 PSPMDVSNAKGRANLFPTG 145 P+P +NA +AN FPTG Sbjct: 798 PAPTSRNNASDKANAFPTG 816 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,568,130 Number of Sequences: 59808 Number of extensions: 261944 Number of successful extensions: 415 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -