BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20780 (416 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92811-3|CAB07274.1| 1083|Caenorhabditis elegans Hypothetical pr... 27 4.1 Z92789-9|CAB07223.1| 1083|Caenorhabditis elegans Hypothetical pr... 27 4.1 U64848-5|AAB04884.1| 330|Caenorhabditis elegans Hypothetical pr... 26 9.5 >Z92811-3|CAB07274.1| 1083|Caenorhabditis elegans Hypothetical protein T01G1.3 protein. Length = 1083 Score = 27.5 bits (58), Expect = 4.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 240 GRRTYGPTDGE*LPSPMDVSNAKGRANLFP 151 G Y P+ + P PMD SN + +NL P Sbjct: 810 GFNPYNPSHSQCPPPPMDYSNNRRNSNLTP 839 >Z92789-9|CAB07223.1| 1083|Caenorhabditis elegans Hypothetical protein T01G1.3 protein. Length = 1083 Score = 27.5 bits (58), Expect = 4.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 240 GRRTYGPTDGE*LPSPMDVSNAKGRANLFP 151 G Y P+ + P PMD SN + +NL P Sbjct: 810 GFNPYNPSHSQCPPPPMDYSNNRRNSNLTP 839 >U64848-5|AAB04884.1| 330|Caenorhabditis elegans Hypothetical protein C50E3.9 protein. Length = 330 Score = 26.2 bits (55), Expect = 9.5 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -2 Query: 280 FMCNLHFFYYCSFR 239 F+ L++FYYC+FR Sbjct: 195 FVITLNYFYYCTFR 208 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,719,701 Number of Sequences: 27780 Number of extensions: 209307 Number of successful extensions: 396 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 396 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 683806592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -