BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20780 (416 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g22140.1 68415.m02630 expressed protein ; expression supporte... 27 3.8 At3g28007.1 68416.m03496 nodulin MtN3 family protein contains Pf... 26 8.9 At2g42220.1 68415.m05225 rhodanese-like domain-containing protei... 26 8.9 >At2g22140.1 68415.m02630 expressed protein ; expression supported by MPSS Length = 506 Score = 27.5 bits (58), Expect = 3.8 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 233 GHTAQLMVSSYRLPWTSAMPRAEPTYSLPVTKIY 132 G T+ L +RL A+P+ +P Y+L V K Y Sbjct: 396 GLTSSLASCQFRLKALVAIPKVQPRYALAVWKKY 429 >At3g28007.1 68416.m03496 nodulin MtN3 family protein contains Pfam PF03083 MtN3/saliva family; similar to LIM7 GI:431154 (induced in meiotic prophase in lily microsporocytes) from [Lilium longiflorum] Length = 251 Score = 26.2 bits (55), Expect = 8.9 Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = -3 Query: 345 IIYSGFIYLFHSNHKRLNNLNTLCVIYI-FFIIAPL 241 I+ + + LFH++++R + + CVI++ IAPL Sbjct: 115 IVATCTLLLFHTHNQRSSFVGIFCVIFVSLMYIAPL 150 >At2g42220.1 68415.m05225 rhodanese-like domain-containing protein contains rhodanese-like domain PF:00581 Length = 234 Score = 26.2 bits (55), Expect = 8.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 180 NAKGRANLFPTGYQNICAITNGIDSTK 100 +A + L GY+NI +T+G+ S K Sbjct: 151 SAAAASRLEEAGYENIACVTSGLQSVK 177 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,902,528 Number of Sequences: 28952 Number of extensions: 184058 Number of successful extensions: 305 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 305 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 635399168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -