BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20775 (760 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 23 3.5 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 4.6 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 21 8.1 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/31 (25%), Positives = 18/31 (58%) Frame = +1 Query: 502 GVPVNSVDDLTEDALGFAGLVYEHVLGEDKF 594 G+ +++D + A+ F G+ +L +DK+ Sbjct: 74 GITTDTIDRVFTVAIPFVGIANSCILNQDKW 104 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 2/19 (10%) Frame = -3 Query: 620 GFL--HCSTKVNLSSPSTC 570 GF+ HC +KVN + S C Sbjct: 329 GFMGRHCESKVNFCATSPC 347 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.4 bits (43), Expect = 8.1 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 114 TATETVLVKGLVMDHGARHPDMPKRVE 194 TATE + + GL+ + D P+ V+ Sbjct: 122 TATEQLCIGGLLYNERTHSCDWPENVD 148 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,274 Number of Sequences: 336 Number of extensions: 3577 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -