BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20773 (815 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 29 0.17 AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse t... 24 6.4 AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding pr... 23 8.5 AJ618921-1|CAF02000.1| 172|Anopheles gambiae putative odorant-b... 23 8.5 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 29.1 bits (62), Expect = 0.17 Identities = 18/55 (32%), Positives = 24/55 (43%) Frame = +2 Query: 5 KHNVSCKLTGRV*TEIVTMLGHKINSNKIKNVCTVFRSTNILKHLCNNNRTISSF 169 KHN CKL R ++ + K +N T R+ I K+LC R I F Sbjct: 272 KHN-RCKLAEREMKDLEKPKTEAVEYLKQENTLTRTRNQQIQKYLCEQKRKIGEF 325 >AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 23.8 bits (49), Expect = 6.4 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = -2 Query: 451 VVSWINQYCHNQQYIVRVRRRL 386 +V W+ Y N+ YIV++ + + Sbjct: 97 LVQWLKSYLINRTYIVKIDKHM 118 >AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding protein OBPjj5a protein. Length = 272 Score = 23.4 bits (48), Expect = 8.5 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +3 Query: 60 CWDIKLIQTK*KTCVQ---YFEVQTF*NTCVTTIEQ 158 C DIK+ TK +C Q + ++T+ N C+ T+ + Sbjct: 27 CMDIKIFTTKVASCCQLEEFLTLKTYGN-CLNTMAE 61 >AJ618921-1|CAF02000.1| 172|Anopheles gambiae putative odorant-binding protein OBP5479 protein. Length = 172 Score = 23.4 bits (48), Expect = 8.5 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +3 Query: 60 CWDIKLIQTK*KTCVQ---YFEVQTF*NTCVTTIEQ 158 C DIK+ TK +C Q + ++T+ N C+ T+ + Sbjct: 27 CMDIKIFTTKVASCCQLEEFLTLKTYGN-CLNTMAE 61 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 852,944 Number of Sequences: 2352 Number of extensions: 17498 Number of successful extensions: 32 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86487024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -