BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20772 (470 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. 26 0.76 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 24 2.3 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 23 5.4 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 23 5.4 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 23 5.4 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 23 5.4 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 23 7.1 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 23 7.1 CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein ... 22 9.4 AY659929-1|AAT51797.1| 140|Anopheles gambiae lysozyme c-2 protein. 22 9.4 >L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. Length = 229 Score = 25.8 bits (54), Expect = 0.76 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 21 LHLVLNVRGGGQLFNK 68 LHLVL +RGG Q+F K Sbjct: 67 LHLVLRLRGGMQIFVK 82 Score = 25.8 bits (54), Expect = 0.76 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 21 LHLVLNVRGGGQLFNK 68 LHLVL +RGG Q+F K Sbjct: 143 LHLVLRLRGGMQIFVK 158 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 24.2 bits (50), Expect = 2.3 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 Query: 232 STHGRFKGVLRFRMDSLLLMVTKLLFSQKGTLRPFR 339 + HGRF DS+ + T L S++ LRP R Sbjct: 556 TAHGRFHN--HNSSDSMRTLTTSLTVSRRSCLRPAR 589 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 145 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 234 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 145 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 234 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 145 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 234 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 5.4 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 145 ASIEKGAQVVAINDPFIGLDYMVYLFKYDS 234 A +EKG N+ ++ Y V+ F Y+S Sbjct: 89 AFLEKGELFSIYNEQYLRQTYAVFTFLYNS 118 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 22.6 bits (46), Expect = 7.1 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 280 LLLMVTKLLFSQKGTLRPFRGEKLGLNML*SLLVSL 387 LL+ + +FSQKGT R +KL ++ S L L Sbjct: 39 LLIQIGNGIFSQKGTKFDERYDKLAKDLYKSELKPL 74 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 22.6 bits (46), Expect = 7.1 Identities = 7/27 (25%), Positives = 16/27 (59%) Frame = +3 Query: 357 EYVVESTGVFTTTDKASAHLEGGAKKV 437 + + +G +TT+++ H+EG K + Sbjct: 285 DLITRYSGQISTTEQSVTHIEGRCKAI 311 >CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein protein. Length = 277 Score = 22.2 bits (45), Expect = 9.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 Query: 163 LLFQ*KHGAPNGQCGQI 113 LL Q HG + +CGQ+ Sbjct: 170 LLRQLNHGGDHAECGQV 186 >AY659929-1|AAT51797.1| 140|Anopheles gambiae lysozyme c-2 protein. Length = 140 Score = 22.2 bits (45), Expect = 9.4 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +2 Query: 374 YWCLYHYR*SICSL 415 YWC HY ++C++ Sbjct: 79 YWCDSHYGSNLCNI 92 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 515,915 Number of Sequences: 2352 Number of extensions: 10549 Number of successful extensions: 24 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 41245467 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -