BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20771 (770 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 24 1.2 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 22 6.2 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 22 6.2 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 287 EWEYTSNITKENEEKSIQ 340 +WEY +N KEN K +Q Sbjct: 144 DWEYPANADKENFVKLLQ 161 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 21.8 bits (44), Expect = 6.2 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -2 Query: 631 TPQGLGSWRISQLSQAPKIDRIYFHSCTSRSSQWHS-SIPFPYSSHQSLEF 482 +PQ + S S Q +DR+ H+ ++QW+S +I Y +L++ Sbjct: 166 SPQSVASTASSADHQI--VDRLLSHAPIDSANQWYSQTIDNSYQFCDNLQY 214 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 21.8 bits (44), Expect = 6.2 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -2 Query: 631 TPQGLGSWRISQLSQAPKIDRIYFHSCTSRSSQWHS-SIPFPYSSHQSLEF 482 +PQ + S S Q +DR+ H+ ++QW+S +I Y +L++ Sbjct: 157 SPQSVASTASSADHQI--VDRLLSHAPIDSANQWYSQTIDNSYQFCDNLQY 205 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,321 Number of Sequences: 336 Number of extensions: 3492 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20753800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -