BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20765 (754 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 22 6.0 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 8.0 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.8 bits (44), Expect = 6.0 Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 6/49 (12%) Frame = -2 Query: 147 PGLH-EAVHGVLVLGR-----LQALHARFDDIYGRVAEHRGSSSYTTEQ 19 P +H E ++ + GR L++LH+ +++ +H SSSY++ + Sbjct: 217 PWIHNETIYSLTPQGRKEQKVLKSLHSFSNNVIAERKKHFSSSSYSSRK 265 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +2 Query: 431 EGWGSRCNYTETLELISQAVWRHLRCDVYGNYW 529 +GW + + +L V RH GNYW Sbjct: 125 QGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYW 157 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,575 Number of Sequences: 336 Number of extensions: 3290 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -