BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20763 (794 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0521 + 3768072-3768239,3768280-3768337,3769197-3769659,376... 34 0.11 03_05_0864 - 28362146-28362500,28362585-28362629,28362727-28363085 28 7.4 >02_01_0521 + 3768072-3768239,3768280-3768337,3769197-3769659, 3769736-3769990,3770763-3770934,3772260-3772910, 3773659-3774045,3774123-3774155,3774239-3774307, 3774388-3774463,3775135-3775223,3775442-3775615, 3775693-3775821 Length = 907 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -3 Query: 501 LLFFFKLISKTQCGYVT*VIIILNIAVLSEIYRKILYFHM 382 +LFF KL+ +CG ++ I + ++ Y+K+LYF + Sbjct: 608 ILFFHKLMDTVECGNTEDTVLAKAITIATQSYQKMLYFQI 647 >03_05_0864 - 28362146-28362500,28362585-28362629,28362727-28363085 Length = 252 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +3 Query: 189 SIVFTFSNFKRRNTLGRVT*PVTRGP*CKGIEHVFRWQIFGGYVIEVLP 335 + V TF + KR L + P TRG C+G+E+V R GG V+P Sbjct: 166 AFVDTFGDGKRPLALVMGSRPYTRGM-CEGVEYVLRSMRAGGKRRVVVP 213 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,715,445 Number of Sequences: 37544 Number of extensions: 335780 Number of successful extensions: 657 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2150667972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -