BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20763 (794 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-... 58 7e-11 M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 57 2e-10 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 24 1.4 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 23 2.5 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 2.5 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 2.5 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 2.5 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 23 3.3 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 23 3.3 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 23 3.3 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 23 3.3 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 22 5.7 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 7.5 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 7.5 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 22 7.5 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 22 7.5 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 22 7.5 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 22 7.5 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 22 7.5 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 7.5 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 10.0 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 10.0 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 10.0 >M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E30. ). Length = 109 Score = 58.4 bits (135), Expect = 7e-11 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 3 KASGQRNPLALQLMAQGLYNHSTVTESDDEEEI 101 KASGQ+NPLALQLMAQGLYNHSTV +D EEI Sbjct: 77 KASGQKNPLALQLMAQGLYNHSTVPVDEDGEEI 109 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 56.8 bits (131), Expect = 2e-10 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 KASGQRNPLALQLMAQGLYNHSTVTESDDEEE 98 KASGQ+NPLALQLMAQGLYNHSTV + +EEE Sbjct: 77 KASGQKNPLALQLMAQGLYNHSTVPLTKEEEE 108 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 24.2 bits (50), Expect = 1.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 346 LRNSGKTSMTYPPKICHRKTCSIPLHYGP 260 +R SG S+TY + C + LHY P Sbjct: 141 VRLSGDGSVTYGMRFTTTLACMMDLHYYP 169 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.4 bits (48), Expect = 2.5 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = +3 Query: 342 RKFVFGFSYFQMLPYENTEFFGKFQTRP 425 +K + +Y + +P ++G F RP Sbjct: 105 KKLYYNINYIEQIPIPVPVYYGNFPPRP 132 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 2.5 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = +3 Query: 342 RKFVFGFSYFQMLPYENTEFFGKFQTRP 425 +K + +Y + +P ++G F RP Sbjct: 110 KKLYYNINYIEQIPIPVPVYYGNFPPRP 137 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 2.5 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = +3 Query: 342 RKFVFGFSYFQMLPYENTEFFGKFQTRP 425 +K + +Y + +P ++G F RP Sbjct: 110 KKLYYNINYIEQIPIPVPVYYGNFPPRP 137 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 2.5 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = +3 Query: 342 RKFVFGFSYFQMLPYENTEFFGKFQTRP 425 +K + +Y + +P ++G F RP Sbjct: 110 KKLYYNINYIEQIPIPVPVYYGNFPPRP 137 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 3.3 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = +3 Query: 342 RKFVFGFSYFQMLPYENTEFFGKFQTRP 425 +K + +Y + +P ++G F RP Sbjct: 106 KKLYYNINYIEQIPIPVPVYYGNFLPRP 133 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 3.3 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = +3 Query: 342 RKFVFGFSYFQMLPYENTEFFGKFQTRP 425 +K + +Y + +P ++G F RP Sbjct: 106 KKLYYNINYIEQIPIPVPVYYGNFLPRP 133 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 3.3 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = +3 Query: 342 RKFVFGFSYFQMLPYENTEFFGKFQTRP 425 +K + +Y + +P ++G F RP Sbjct: 106 KKLYYNINYIEQIPIPVPVYYGNFLPRP 133 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.0 bits (47), Expect = 3.3 Identities = 7/28 (25%), Positives = 14/28 (50%) Frame = +3 Query: 342 RKFVFGFSYFQMLPYENTEFFGKFQTRP 425 +K + +Y + +P ++G F RP Sbjct: 106 KKLYYNINYIEQIPIPVPVYYGNFLPRP 133 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 5.7 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = +3 Query: 342 RKFVFGFSYFQMLPYENTEFFGKFQTRP 425 RK + +Y + +P + G F RP Sbjct: 105 RKLYYNINYIEQIPIPVPIYCGNFPPRP 132 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.8 bits (44), Expect = 7.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 268 NARELNMFFGGKFLADMS*RFCLNY 342 NA + F GG +L + R C+NY Sbjct: 474 NAVAVENFKGGMYLRLKARRACMNY 498 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.8 bits (44), Expect = 7.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 268 NARELNMFFGGKFLADMS*RFCLNY 342 NA + F GG +L + R C+NY Sbjct: 474 NAVAVENFKGGMYLRLKARRACMNY 498 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.5 Identities = 6/28 (21%), Positives = 14/28 (50%) Frame = +3 Query: 342 RKFVFGFSYFQMLPYENTEFFGKFQTRP 425 ++ + +Y + +P ++G F RP Sbjct: 100 KQLCYNINYIEQIPVPVPVYYGNFPPRP 127 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.5 Identities = 6/28 (21%), Positives = 14/28 (50%) Frame = +3 Query: 342 RKFVFGFSYFQMLPYENTEFFGKFQTRP 425 ++ + +Y + +P ++G F RP Sbjct: 100 KQLCYNINYIEQIPVPVPVYYGNFPPRP 127 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.5 Identities = 6/28 (21%), Positives = 14/28 (50%) Frame = +3 Query: 342 RKFVFGFSYFQMLPYENTEFFGKFQTRP 425 ++ + +Y + +P ++G F RP Sbjct: 100 KQLCYNINYIEQIPVPVPVYYGNFPPRP 127 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.5 Identities = 6/28 (21%), Positives = 14/28 (50%) Frame = +3 Query: 342 RKFVFGFSYFQMLPYENTEFFGKFQTRP 425 ++ + +Y + +P ++G F RP Sbjct: 100 KQLCYNINYIEQIPVPVPVYYGNFPPRP 127 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.8 bits (44), Expect = 7.5 Identities = 6/28 (21%), Positives = 14/28 (50%) Frame = +3 Query: 342 RKFVFGFSYFQMLPYENTEFFGKFQTRP 425 ++ + +Y + +P ++G F RP Sbjct: 100 KQLCYNINYIEQIPVPVPVYYGNFPPRP 127 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.8 bits (44), Expect = 7.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -3 Query: 585 LLDYCHYLNTNKYIYIIRNIFVLFIY 508 L DYC+ + T+ I+ +I V F Y Sbjct: 358 LEDYCNIVATHLVCGILGSILVPFFY 383 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 10.0 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 546 YIYLYLNNGNSQVIVKKNIYYSISSL 623 Y Y Y NN + K +YY+I ++ Sbjct: 94 YKYNYNNNNYNNNNYNKKLYYNIINI 119 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 10.0 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 546 YIYLYLNNGNSQVIVKKNIYYSISSL 623 Y Y Y NN + K +YY+I ++ Sbjct: 94 YKYNYNNNNYNNNNYNKKLYYNIINI 119 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 10.0 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 Query: 328 FCLNYVSLFSGLATSKCCHMKIQNFSVNFR 417 F YV+ SG+ + C H+K N R Sbjct: 138 FDCRYVTTTSGMFEALCNHIKYSTNKGNIR 167 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,714 Number of Sequences: 438 Number of extensions: 4840 Number of successful extensions: 48 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25125039 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -