BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20762 (726 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC577.12 |mug71||endoribonuclease |Schizosaccharomyces pombe|c... 26 6.3 SPCC61.05 |||S. pombe specific multicopy membrane protein family... 25 8.3 >SPBC577.12 |mug71||endoribonuclease |Schizosaccharomyces pombe|chr 2|||Manual Length = 606 Score = 25.8 bits (54), Expect = 6.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 237 CSQKIKSTTKDKSVWQP 287 C K+K+ KDK WQP Sbjct: 232 CYLKVKACVKDKPEWQP 248 >SPCC61.05 |||S. pombe specific multicopy membrane protein family 1|Schizosaccharomyces pombe|chr 3|||Manual Length = 469 Score = 25.4 bits (53), Expect = 8.3 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 642 TALSFVEAFNFRTLSPCSAIAFSKLATSPAAWFA 541 + ++FV+ F L CS F K P W+A Sbjct: 419 SCITFVDFLVFAFLFDCSKFVFLKYQPIPFEWYA 452 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,189,426 Number of Sequences: 5004 Number of extensions: 32221 Number of successful extensions: 86 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 341222980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -