BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20762 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.2 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 2.9 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 2.9 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 9.0 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.4 bits (48), Expect = 2.2 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -2 Query: 695 VLGDVFSDRAIHLLQAATRPCLLL--RLSISGLC 600 V+G++ A+ L++ RPC L L++S LC Sbjct: 56 VIGNILVCVAVFLVRKLRRPCNYLLVSLAVSDLC 89 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 677 SDRAIHLLQAATRPCLLLR 621 S+ ++H ++ T PCLL R Sbjct: 614 SEESVHSMELRTLPCLLPR 632 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 677 SDRAIHLLQAATRPCLLLR 621 S+ ++H ++ T PCLL R Sbjct: 582 SEESVHSMELRTLPCLLPR 600 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 427 LTASPCSAIAFSKLATSPAAW 365 +T+S CS +A KL+ + + W Sbjct: 336 ITSSSCSYMAHEKLSYAFSVW 356 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,527 Number of Sequences: 438 Number of extensions: 2110 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -