BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20759 (794 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49633| Best HMM Match : FAD_binding_7 (HMM E-Value=0) 29 4.3 SB_48526| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) 29 4.3 SB_20868| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_3100| Best HMM Match : SCP (HMM E-Value=1.5e-20) 29 4.3 SB_52861| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_28322| Best HMM Match : Ion_trans (HMM E-Value=1.6e-41) 29 5.7 SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_42947| Best HMM Match : 7tm_1 (HMM E-Value=0.00011) 29 5.7 SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) 28 7.6 SB_31112| Best HMM Match : Dynein_heavy (HMM E-Value=0) 28 7.6 >SB_49633| Best HMM Match : FAD_binding_7 (HMM E-Value=0) Length = 1291 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +3 Query: 180 PPPAYRHRVSTSVQIAKIAALTVVAPPSSWEPLYWLR 290 P P H + V + ++ ALT+ PP + ++W R Sbjct: 688 PEPVCDHLLQRRVCVERLHALTMSLPPKTHNTMHWFR 724 >SB_48526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 111 PDSMATITMKPEYPPSEVYSTSEPPPAYRHRVS 209 PD AT + PEY + +PPP Y ++ Sbjct: 28 PDMPATFQIPPEYTVEDPIKIDQPPPPYMDTIT 60 >SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) Length = 1079 Score = 29.1 bits (62), Expect = 4.3 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = +3 Query: 108 QPDSM-ATITMKPEYPPSEVYSTSEPPPAYRHRVSTSVQIAK-IAALTVVAPPSSWEP 275 +P S+ A+I+ KP + V T+ P P S SV +A + A +VVA P S EP Sbjct: 151 EPSSVVASISFKPSAAGASV-PTAPPVPVVSATFSPSVVVASALVAPSVVASPISSEP 207 >SB_20868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 159 EVYSTSEPPPAYRHRVSTSVQIAKIAALTVVAPPSSW 269 ++YST+EP A+ R+S + I + + PP S+ Sbjct: 57 DIYSTNEPQGAFHQRISFCLDIYNQSVKAMRFPPKSY 93 >SB_3100| Best HMM Match : SCP (HMM E-Value=1.5e-20) Length = 191 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 Query: 725 TTKKGRMNCVWSV*R 769 T+KKGRMNC+W V R Sbjct: 136 TSKKGRMNCLWVVAR 150 >SB_52861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1487 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 447 RPCCLQCYLRRASRHLHDPVSQRRRTQPCRVQNKRRQI 560 R C YL+ S HLH ++ RR +NKRR+I Sbjct: 841 RTDCRAEYLQATSEHLHLQIAICRRPASKMEENKRREI 878 >SB_28322| Best HMM Match : Ion_trans (HMM E-Value=1.6e-41) Length = 263 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/61 (26%), Positives = 32/61 (52%) Frame = -3 Query: 717 ESARQLIKVKLNRQFEHRSNRFKFVVLFSRTVGLRTLITRVW*VILIVVNFLQFVFVYFG 538 E+ +LI KLN F N F F+++ + VG+ + + +++++ L FV+ G Sbjct: 81 EAILKLIAFKLN-YFRDYWNVFDFIIVVTTLVGVLLELVQALPYVVMLIAMLFFVYAVIG 139 Query: 537 L 535 + Sbjct: 140 M 140 >SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +3 Query: 99 KEHQPDSMATITMKPEYPPSEVYSTSEPPPAYRHRVSTSVQ 221 + H P S + T +P PP +T++ PPAY R S ++Q Sbjct: 91 RPHTPPSCQSNTPRPLTPPPRQSNTTQ-PPAYPPRQSYALQ 130 >SB_42947| Best HMM Match : 7tm_1 (HMM E-Value=0.00011) Length = 380 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = -3 Query: 588 VILIVVNFLQFVFVYFGLGMVECVVFERLGREDDGWLVSGNTEDSMGG 445 V +I N + FVY G F R+ R DDG+ +G D G Sbjct: 313 VCMIYTNAVINAFVYAGFNSEFRRTFRRIYRRDDGFSSNGGNRDRRRG 360 >SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) Length = 2114 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -1 Query: 413 AKAHPLPGHHFRRLCLPKRVLGRALHPAALADGM---MNELLPNSKPI 279 A+ H LP H + K LGR L+ +L G+ ++++LPN K + Sbjct: 533 ARRHELPKHITKVTISEKTRLGRKLYKCSLMKGVKRQVSDVLPNIKSV 580 >SB_31112| Best HMM Match : Dynein_heavy (HMM E-Value=0) Length = 2532 Score = 28.3 bits (60), Expect = 7.6 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 6/65 (9%) Frame = +2 Query: 293 WVAARSSCHQLEQLDAMLDQ------ELALEGRAYGNDALVADEPLPLANAHALHGVPPM 454 W ARS+ + E+LD + ++ +L LEG G +PL N + + + M Sbjct: 336 WCNARSNAKEREELDRLFEKYVPASVDLILEGILDGKQGKKLKTIIPLTNLNMVEQLSHM 395 Query: 455 LSSVL 469 L ++L Sbjct: 396 LDALL 400 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,479,162 Number of Sequences: 59808 Number of extensions: 498680 Number of successful extensions: 1367 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1211 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1364 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2191792647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -