BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20758 (721 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16D10.05 |mok13||alpha-1,3-glucan synthase Mok13|Schizosacch... 27 2.0 SPBC216.02 |mcp5|num1, mug21|cortical anchoring factor for dynei... 25 8.2 >SPBC16D10.05 |mok13||alpha-1,3-glucan synthase Mok13|Schizosaccharomyces pombe|chr 2|||Manual Length = 2358 Score = 27.5 bits (58), Expect = 2.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 579 WWVRALIVTAYSSLSACFLLPCAS*FLCG 493 WW ++ + +SLS FLL CAS L G Sbjct: 1978 WWYLYRMLPSVASLSLPFLLYCASFLLIG 2006 >SPBC216.02 |mcp5|num1, mug21|cortical anchoring factor for dynein Mcp5/Num1|Schizosaccharomyces pombe|chr 2|||Manual Length = 968 Score = 25.4 bits (53), Expect = 8.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 590 MSMYGGFVL*SLQHTVVYRHVSCYRALVNF 501 ++ YG VL +QH ++ H C + + +F Sbjct: 537 LNSYGNHVLNRIQHDILENHFCCLKNVKDF 566 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,976,965 Number of Sequences: 5004 Number of extensions: 60181 Number of successful extensions: 137 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 137 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -