BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20758 (721 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.9 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 23 2.9 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 5.1 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 21 8.9 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 137 TGTTSYIRNLF*LIQN 90 T T SYIR+ F L+QN Sbjct: 540 TPTDSYIRSFFELLQN 555 Score = 21.4 bits (43), Expect = 8.9 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +2 Query: 509 LAHGNRKHADKLLYAVTIRARTHHTLTCSADTCSVLIVDKMSPAAS 646 L N K A +LY + + H + C+A V ++ K +P S Sbjct: 674 LTETNPKLARSVLYKIYLNTMESHEVRCTA----VFLLMKTNPPLS 715 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 656 GAQEAHSPSKTIPKTLNIMEHL 721 G+ SP+ + P TLN+ME + Sbjct: 22 GSTTPASPTLSTPPTLNLMEQI 43 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 5.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 Query: 247 KAHRATLLRIISYFKKLEPLNSDKC 173 KAH+ L SYF+KL L S+ C Sbjct: 48 KAHKVVLSACSSYFQKL--LLSNPC 70 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -1 Query: 151 YTKQTPAQRHTSEIYFN 101 Y K TP Q+H I N Sbjct: 216 YKKPTPVQKHALPIIMN 232 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,197 Number of Sequences: 438 Number of extensions: 4542 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -