BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20757 (762 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPJ691.03 |||DUF543 family protein|Schizosaccharomyces pombe|c... 28 1.3 SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe... 27 3.9 >SPAPJ691.03 |||DUF543 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 86 Score = 28.3 bits (60), Expect = 1.3 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +1 Query: 91 MSRSQNNTTDDYSAKIDMCLTDGIVKTXXXXXXXXXXXXXFLKRRRWPIIAGMG 252 MS SQ++ + + D+CL++ +V++ F +R WP+ G+G Sbjct: 1 MSTSQSSE-QTLNYQWDVCLSNMVVQSGIGLGAGIVSSVLFFRRAAWPVWGGLG 53 >SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 310 Score = 26.6 bits (56), Expect = 3.9 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 Query: 690 GGRAHSPPGVKWLLEPIDIYN 752 GG H P V WLL P DIY+ Sbjct: 235 GGPLHDPNTVMWLLRP-DIYS 254 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,801,296 Number of Sequences: 5004 Number of extensions: 51947 Number of successful extensions: 98 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 365309308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -