BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20757 (762 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024136-2|AAF35960.2| 105|Caenorhabditis elegans Hypothetical ... 35 0.055 AF003385-5|AAB54245.1| 494|Caenorhabditis elegans Hypothetical ... 28 8.3 >AC024136-2|AAF35960.2| 105|Caenorhabditis elegans Hypothetical protein F54A3.5 protein. Length = 105 Score = 35.1 bits (77), Expect = 0.055 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = +1 Query: 106 NNTTDDYSAKIDMCLTDGIVKTXXXXXXXXXXXXXFLKRRRWPIIAGMGV 255 + + D+ KID C D ++K F K R WPI G GV Sbjct: 11 SRSEDEVGQKIDRCFADSLLKVTGGVAIGIVASVAFFKSRSWPIWFGSGV 60 >AF003385-5|AAB54245.1| 494|Caenorhabditis elegans Hypothetical protein R08F11.3 protein. Length = 494 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = -2 Query: 254 TPIPAMIGHLLLFRKRTEARPPSKTPLPVF--TMPSV 150 T I + HLL +++R PP TPLP+F T+P++ Sbjct: 10 TGISIYLFHLLYWKRRN--LPPGPTPLPLFGNTLPTL 44 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,414,538 Number of Sequences: 27780 Number of extensions: 290576 Number of successful extensions: 563 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1819579054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -