BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20756 (702 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 26 1.3 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 26 1.3 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 2.3 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 3.0 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 24 4.0 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 9.3 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 9.3 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 25.8 bits (54), Expect = 1.3 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 388 KHTETCEKNSLPTKDVIEQEKS 453 K+T TCE +LP +DV+ + S Sbjct: 477 KNTTTCEDYALPYQDVVPSDPS 498 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.8 bits (54), Expect = 1.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 620 RGCCTPPLPRQCCH 579 +G C P PR+CCH Sbjct: 190 QGRCFGPKPRECCH 203 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 25.0 bits (52), Expect = 2.3 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = -1 Query: 609 YAAIAQAVLPLYKNKNKTCNGRRKSI 532 Y + QAVLPL KN N CN R+SI Sbjct: 536 YIVLVQAVLPLDKNLN-DCN--RQSI 558 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 24.6 bits (51), Expect = 3.0 Identities = 13/64 (20%), Positives = 30/64 (46%) Frame = +2 Query: 440 SKRNQLEPLLYNSYSQMYLASIAYFNIDVSQIDLRRPLQVLFLFLYNGNTAWAMAAYSNP 619 +K +LE +++ + + ++ + +++ D P+ L L + N + AYS Sbjct: 378 NKITKLESEIFSDLYTLQILNLRHNQLEIIAADTFSPMNNLHTLLLSHNKLKYLDAYSLN 437 Query: 620 GFYS 631 G Y+ Sbjct: 438 GLYA 441 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 24.2 bits (50), Expect = 4.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 Query: 200 QTEAQSFHWCRRHGD 156 QT +Q+ HW + HGD Sbjct: 222 QTLSQANHWLKSHGD 236 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.0 bits (47), Expect = 9.3 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = -1 Query: 402 RFRVLQLSGIEVLDAVQEFVLFLLRFDS 319 R ++ L +E+++ +Q+F F FD+ Sbjct: 7 RVKMFNLKRVEIMNTLQDFEEFTKSFDA 34 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.0 bits (47), Expect = 9.3 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +2 Query: 491 YLASIAYFNIDVSQIDLRRPLQV 559 Y + YFNI+ QID++ L++ Sbjct: 1139 YKKNTKYFNINSEQIDVQNFLEI 1161 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 712,612 Number of Sequences: 2352 Number of extensions: 14661 Number of successful extensions: 24 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -