BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20755 (702 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55238| Best HMM Match : Serpin (HMM E-Value=0) 51 8e-07 SB_38975| Best HMM Match : Serpin (HMM E-Value=0) 49 4e-06 SB_55237| Best HMM Match : Serpin (HMM E-Value=0) 45 7e-05 SB_5257| Best HMM Match : SlyX (HMM E-Value=2.2) 29 2.8 SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) 29 3.6 SB_55414| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-08) 29 4.8 SB_4415| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_55378| Best HMM Match : Connexin50 (HMM E-Value=1.8) 28 8.4 SB_27683| Best HMM Match : Exo_endo_phos (HMM E-Value=1.5e-20) 28 8.4 SB_24891| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_11238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_48263| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_30045| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_29987| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_55238| Best HMM Match : Serpin (HMM E-Value=0) Length = 345 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/61 (34%), Positives = 33/61 (54%) Frame = +2 Query: 509 DLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSQDKTIKVPMMYKRGDYK 688 DL+ P + T LVNAIYFKG W F + + +F + ++V MM+++ +K Sbjct: 110 DLIAPGVFNMLTRLTLVNAIYFKGMWDKPFKKEHSHSSEFRTTSSNEVEVEMMFQKSKFK 169 Query: 689 Y 691 Y Sbjct: 170 Y 170 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +3 Query: 330 ELKMANKVYVHDGGKLDENFAVVSRDVFNSDVQNIDFSKNTVAA-KSINDWVEENTNNRI 506 E+ +AN +++ + + F + + +++D+ +D+ + A K +N WVEE T +I Sbjct: 49 EMSIANNLFLQKDFSILKEFTDICQKYYDADISLVDYKTDFEGARKHVNQWVEERTKKKI 108 >SB_38975| Best HMM Match : Serpin (HMM E-Value=0) Length = 380 Score = 48.8 bits (111), Expect = 4e-06 Identities = 23/89 (25%), Positives = 53/89 (59%), Gaps = 1/89 (1%) Frame = +3 Query: 246 ESYGFPDDDAIRTEFASKSRDLRSIKGVELKMANKVYVHDGGKLDENFAVVSRDVFNSDV 425 +++ FP D + ++ + + G ++ MAN+++ G ++ E F S++ F++++ Sbjct: 58 KTFHFPTDVPEKFHDFLQALNASNSDGNQILMANRLFAQMGFEILEEFKKASKESFSAEM 117 Query: 426 QNIDFSKNTVAAK-SINDWVEENTNNRIK 509 +D+ KN+ A+ ++N WVE+ T ++IK Sbjct: 118 ALVDYVKNSNGARDTVNRWVEQKTKDKIK 146 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/64 (32%), Positives = 34/64 (53%) Frame = +2 Query: 509 DLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSQDKTIKVPMMYKRGDYK 688 +L+ + T LVNA+YFKG+W F+ T F + + I+V MY+ +++ Sbjct: 147 NLIPEGMFNKDTILCLVNAVYFKGSWMKHFNRNATQSGKFKTTPSQEIQVQFMYQSSEFR 206 Query: 689 YGES 700 Y ES Sbjct: 207 YLES 210 >SB_55237| Best HMM Match : Serpin (HMM E-Value=0) Length = 363 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/61 (32%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Frame = +3 Query: 330 ELKMANKVYVHDGGKLDENFAVVSRDVFNSDVQNIDF-SKNTVAAKSINDWVEENTNNRI 506 E+++ NK++ HD ++ E F +R+ ++S++ +DF +K A K +N WV + T I Sbjct: 54 EIQLVNKIWGHDEFEILEEFLHGTREFYHSEMAQVDFVNKAFDARKEVNAWVHQQTKGNI 113 Query: 507 K 509 K Sbjct: 114 K 114 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 2/58 (3%) Frame = +2 Query: 509 DLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYV--SQDKTIKVPMMYKR 676 +L+ ++S T ++VNA+YFKG W +F E T F+V S + I+V MM ++ Sbjct: 115 ELIPHGVINSLTRLIIVNAVYFKGVWKKEFGEENTFHAAFFVPESHESKIEVEMMTRK 172 >SB_5257| Best HMM Match : SlyX (HMM E-Value=2.2) Length = 641 Score = 29.5 bits (63), Expect = 2.8 Identities = 21/86 (24%), Positives = 42/86 (48%) Frame = +3 Query: 240 AFESYGFPDDDAIRTEFASKSRDLRSIKGVELKMANKVYVHDGGKLDENFAVVSRDVFNS 419 AF + F DD + E S+++D +++ K + K +E+ + S +F+ Sbjct: 420 AFPRFYFLSDDEL-LEILSQTKDPTAVQPHLRKCFENIAKL---KFEEDLRISS--MFSG 473 Query: 420 DVQNIDFSKNTVAAKSINDWVEENTN 497 + +N+DFS + ++ DW+ E N Sbjct: 474 EGENVDFSTDLYPTGNVEDWLLEVEN 499 >SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) Length = 257 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 382 RILQSFPGTSSIRTSKTLISRRIQSQLS 465 R+ SFPG S TL++R QSQ+S Sbjct: 65 RLYDSFPGASRSEAESTLLARMRQSQVS 92 >SB_55414| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-08) Length = 595 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/56 (30%), Positives = 31/56 (55%) Frame = +1 Query: 58 AMAAVTNLSNVLKNGNDNFTARMFTEVVKNNPGKSVVLSAFSVLPPLAQLALASDG 225 +MAAV + +L+ + + + ++KNN +S+ AF+ L L L L+S+G Sbjct: 36 SMAAVCRPAGLLEPDHFALPVAVESLILKNNSIRSIAKGAFNGLDKLLTLDLSSNG 91 >SB_4415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 640 Score = 28.7 bits (61), Expect = 4.8 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 66 CHCRDGDSKQTNDCL 22 CHCRDG+S Q N+ + Sbjct: 336 CHCRDGESVQVNNAM 350 >SB_55378| Best HMM Match : Connexin50 (HMM E-Value=1.8) Length = 455 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 661 GYFDCFVLAHVEVTVTGQSLVKFR 590 GY DC + HV++T TG + K++ Sbjct: 325 GYLDCDHMRHVKITATGGNQSKYQ 348 >SB_27683| Best HMM Match : Exo_endo_phos (HMM E-Value=1.5e-20) Length = 672 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 223 HQKLKLTEREEAAPKMPRGQRFSL 152 HQ L + E + ++PK PR +F L Sbjct: 56 HQNLSINEMDSSSPKRPRQHQFGL 79 >SB_24891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 345 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 223 HQKLKLTEREEAAPKMPRGQRFSL 152 HQ L + E + ++PK PR +F L Sbjct: 21 HQNLSINEMDSSSPKRPRQHQFGL 44 >SB_11238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 223 HQKLKLTEREEAAPKMPRGQRFSL 152 HQ L + E + ++PK PR +F L Sbjct: 50 HQNLSINEMDSSSPKRPRQHQFGL 73 >SB_48263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 223 HQKLKLTEREEAAPKMPRGQRFSL 152 HQ L + E + ++PK PR +F L Sbjct: 21 HQNLSINEMDSSSPKRPRQHQFGL 44 >SB_30045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 27.9 bits (59), Expect = 8.4 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -3 Query: 697 LSIFIIAAFIHHGYFDCF 644 LS++++ +HH YF CF Sbjct: 298 LSLYVVVVTVHHHYFFCF 315 >SB_29987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 223 HQKLKLTEREEAAPKMPRGQRFSL 152 HQ L + E + ++PK PR +F L Sbjct: 7 HQNLSINEMDSSSPKCPRQHQFGL 30 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,645,456 Number of Sequences: 59808 Number of extensions: 407595 Number of successful extensions: 1160 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1160 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -