BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20755 (702 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25240.1 68415.m03020 serpin, putative / serine protease inhi... 57 1e-08 At2g26390.1 68415.m03167 serpin, putative / serine protease inhi... 57 1e-08 At3g45220.1 68416.m04880 serpin, putative / serine protease inhi... 56 2e-08 At1g63280.1 68414.m07154 serpin-related / serine protease inhibi... 52 4e-07 At2g14540.1 68415.m01628 serpin family protein / serine protease... 50 1e-06 At1g51330.1 68414.m05772 serpin-related / serine protease inhibi... 50 1e-06 At1g64030.1 68414.m07252 serpin family protein / serine protease... 49 3e-06 At1g47710.1 68414.m05302 serpin, putative / serine protease inhi... 49 3e-06 At2g35580.1 68415.m04357 serpin family protein / serine protease... 46 2e-05 At1g62170.1 68414.m07013 serpin family protein / serine protease... 45 4e-05 At1g72410.1 68414.m08374 COP1-interacting protein-related simila... 30 1.7 At2g02750.1 68415.m00218 pentatricopeptide (PPR) repeat-containi... 29 2.3 At1g33390.1 68414.m04133 helicase domain-containing protein simi... 29 2.3 At3g01420.1 68416.m00065 pathogen-responsive alpha-dioxygenase, ... 29 3.0 At5g37490.1 68418.m04515 U-box domain-containing protein similar... 29 3.9 At3g54850.1 68416.m06077 armadillo/beta-catenin repeat family pr... 28 6.9 At5g03730.2 68418.m00334 serine/threonine protein kinase (CTR1) ... 27 9.1 At5g03730.1 68418.m00333 serine/threonine protein kinase (CTR1) ... 27 9.1 At1g51980.1 68414.m05863 mitochondrial processing peptidase alph... 27 9.1 >At2g25240.1 68415.m03020 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 324 Score = 57.2 bits (132), Expect = 1e-08 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = +2 Query: 524 DSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSQDKTIKVPMM 667 D++ S+T VL NA+YFKGAWSSKFD +T DF++ ++KVP M Sbjct: 95 DTIRSSTL-VLANAVYFKGAWSSKFDANMTKKNDFHLLDGTSVKVPFM 141 Score = 31.1 bits (67), Expect = 0.74 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +3 Query: 327 VELKMANKVYVHDGGKLDENFAVVSRDVFNSDVQNIDF-SKNTVAAKSINDWVEENTNNR 503 + L +AN V++ L +F + + + + +DF SK + +N W E +TN Sbjct: 25 LRLSIANGVWIDKFFSLKLSFKDLLENSYKATCSQVDFASKPSEVIDEVNTWAEVHTNGL 84 Query: 504 IK 509 IK Sbjct: 85 IK 86 >At2g26390.1 68415.m03167 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 389 Score = 56.8 bits (131), Expect = 1e-08 Identities = 23/44 (52%), Positives = 29/44 (65%) Frame = +2 Query: 551 VLVNAIYFKGAWSSKFDERLTSDRDFYVSQDKTIKVPMMYKRGD 682 +L NA+YFK AWS KFD +LT D DF++ T+KVP M D Sbjct: 168 ILANAVYFKAAWSRKFDAKLTKDNDFHLLDGNTVKVPFMMSYKD 211 >At3g45220.1 68416.m04880 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 393 Score = 56.0 bits (129), Expect = 2e-08 Identities = 26/65 (40%), Positives = 42/65 (64%), Gaps = 4/65 (6%) Frame = +2 Query: 509 DLVNPDSLSSATAAVLV--NAIYFKGAWSSKFDERLTSDRDFYVSQDKTIKVPMM--YKR 676 ++++ DS+ + ++L+ NA+YFKGAWS KFD +LT DF++ +KVP M YK+ Sbjct: 152 EILSDDSIKTIRESMLILANAVYFKGAWSKKFDAKLTKSYDFHLLDGTMVKVPFMTNYKK 211 Query: 677 GDYKY 691 +Y Sbjct: 212 QYLEY 216 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/62 (24%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = +3 Query: 327 VELKMANKVYVHDGGKLDENFAVVSRDVFNSDVQNIDFS-KNTVAAKSINDWVEENTNNR 503 + L A V++ +F + + +N+ +DF+ K +N W E +TN Sbjct: 90 LHLSTAYGVWIDKSLSFKPSFKDLLENSYNATCNQVDFATKPAEVINEVNAWAEVHTNGL 149 Query: 504 IK 509 IK Sbjct: 150 IK 151 >At1g63280.1 68414.m07154 serpin-related / serine protease inhibitor-related similar to protein zx [Hordeum vulgare subsp. vulgare] GI:19071, serpin [Triticum aestivum] GI:1885346 Length = 120 Score = 52.0 bits (119), Expect = 4e-07 Identities = 25/53 (47%), Positives = 33/53 (62%) Frame = +2 Query: 509 DLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSQDKTIKVPMM 667 DL+ S+ S T V NA+YFKGAW +KFD+ T D +F+ Q K + VP M Sbjct: 30 DLLPRGSVKSETVQVYGNALYFKGAWENKFDKSSTKDNEFH--QGKEVHVPFM 80 >At2g14540.1 68415.m01628 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 407 Score = 50.0 bits (114), Expect = 1e-06 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = +2 Query: 527 SLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSQDKTIKVPMM 667 S++S T + NA+YFKGAW FD+ +T D+ F++ K++ VP M Sbjct: 187 SVTSLTNWIYGNALYFKGAWEKAFDKSMTRDKPFHLLNGKSVSVPFM 233 >At1g51330.1 68414.m05772 serpin-related / serine protease inhibitor-related similar to serpin [Hordeum vulgare subsp. vulgare] CAA64599.1 GI:1197577 Length = 193 Score = 50.0 bits (114), Expect = 1e-06 Identities = 23/61 (37%), Positives = 38/61 (62%) Frame = +2 Query: 509 DLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSQDKTIKVPMMYKRGDYK 688 +L+ P S+++ T + NA+YFKGAW +KF + +T + F++ K + VP M K + K Sbjct: 53 NLLPPGSVTNQTIKIYGNALYFKGAWENKFGKSMTIHKPFHLVNGKQVLVPFM-KSYERK 111 Query: 689 Y 691 Y Sbjct: 112 Y 112 >At1g64030.1 68414.m07252 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 [Cucurbita maxima] GI:9937311, serpin [Triticum aestivum] GI:871551; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 385 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/53 (39%), Positives = 31/53 (58%) Frame = +2 Query: 509 DLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSQDKTIKVPMM 667 DL+ S++S T + NA+ FKGAW F++ T D DFY+ ++ VP M Sbjct: 153 DLLPDGSVTSLTNKIYANALSFKGAWKRPFEKYYTRDNDFYLVNGTSVSVPFM 205 Score = 35.9 bits (79), Expect = 0.026 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Frame = +3 Query: 306 DLRSIKGVELKMANKVYVHDGGKLDENFAVVSRDVFNSDVQNIDF-SKNTVAAKSINDWV 482 D + G ++ AN +++ D F + + F + +DF S+ K +N WV Sbjct: 84 DRSATGGPKITAANGLWIDKSLPTDPKFKDLFENFFKAVYVPVDFRSEAEEVRKEVNSWV 143 Query: 483 EENTNNRIK 509 E +TNN IK Sbjct: 144 EHHTNNLIK 152 >At1g47710.1 68414.m05302 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 391 Score = 48.8 bits (111), Expect = 3e-06 Identities = 19/47 (40%), Positives = 27/47 (57%) Frame = +2 Query: 527 SLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSQDKTIKVPMM 667 S S T + NA+YFKG W+ KFDE LT + +F++ + P M Sbjct: 158 SADSMTKLIFANALYFKGTWNEKFDESLTQEGEFHLLDGNKVTAPFM 204 >At2g35580.1 68415.m04357 serpin family protein / serine protease inhibitor family protein similar to protein zx [Hordeum vulgare subsp. vulgare] GI:19071, serpin [Triticum aestivum] GI:1885350; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 374 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 518 NPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSQDKTIKVPMM 667 NP S + T + NA++F G W S+FD LT D DF++ ++VP M Sbjct: 157 NPKS-APLTDHIFANALFFNGRWDSQFDPSLTKDSDFHLLDGTKVRVPFM 205 >At1g62170.1 68414.m07013 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 GI:9937311 from [Cucurbita maxima]; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 433 Score = 45.2 bits (102), Expect = 4e-05 Identities = 19/53 (35%), Positives = 31/53 (58%) Frame = +2 Query: 509 DLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSQDKTIKVPMM 667 DL+ S++S T V +A+YFKG W K+ + +T + FY+ ++ VP M Sbjct: 217 DLLPRGSVTSLTDRVYGSALYFKGTWEEKYSKSMTKCKPFYLLNGTSVSVPFM 269 >At1g72410.1 68414.m08374 COP1-interacting protein-related similar to COP1-Interacting ProteinI 7 (CIP7) [Arabidopsis thaliana] GI:3327870 Length = 1163 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 Query: 174 REDNAFPWIIFHYFGKHSGCEVIVSIFEYIREICDG 67 R D +++F KHS CE+ VS E ++ G Sbjct: 2 RSDTVLDYVVFELSPKHSKCELFVSSNEQTEKLASG 37 >At2g02750.1 68415.m00218 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 613 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 171 EDNAFPWIIFHYFGKHSGCEVIVSIFEYIRE 79 +D F ++ +GKH CE + IFE +RE Sbjct: 434 KDPVFWNVMISGYGKHGECESAIEIFELLRE 464 >At1g33390.1 68414.m04133 helicase domain-containing protein similar to kurz protein [Drosophila melanogaster] GI:5869803; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1237 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +1 Query: 133 EVVKN--NPGKSVVLSAFSVLPPLAQLALASDGETHEELL 246 E VKN +PGK VL +++L P AQL + + E E L+ Sbjct: 636 EQVKNKFSPGKLRVLPLYAMLSPAAQLRVFEEVEKEERLV 675 >At3g01420.1 68416.m00065 pathogen-responsive alpha-dioxygenase, putative similar to pathogen-inducible alpha-dioxygenase [Nicotiana attenuata] GI:12539609; contains Pfam profile PF03098: Animal haem peroxidase Length = 639 Score = 29.1 bits (62), Expect = 3.0 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = +3 Query: 378 DENFAVVSRDVFNSDVQNIDFSKNTVAAKSINDWVEENTNNRIKI*LIRTRSAQPQRLFS 557 DE V DV++ DV+ +D +A K I + T I + ++ TR + R F+ Sbjct: 516 DEEAIEVLDDVYDGDVEELDLLVGLMAEKKIKGFAISETAFYIFL-IMATRRLEADRFFT 574 Query: 558 S 560 S Sbjct: 575 S 575 >At5g37490.1 68418.m04515 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain Length = 435 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 198 ERRQHRKCREDNAFPWIIFHYFGKHSGCEVIVSIFEYI 85 E ++RKC +N+ W++ F K SG E + + I Sbjct: 153 ESEKNRKCVNENSVGWVLCDCFDKFSGDEKLTFMLNEI 190 >At3g54850.1 68416.m06077 armadillo/beta-catenin repeat family protein / U-box domain-containing family protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 632 Score = 27.9 bits (59), Expect = 6.9 Identities = 31/101 (30%), Positives = 47/101 (46%), Gaps = 7/101 (6%) Frame = +1 Query: 49 AIAAMAAVTNLSNVLKNGN----DNFTARMFT-EVVKNNPGKSVVLSAFSVLPPLAQLAL 213 AI A+T++ VLKNG+ +N A +F+ V+ N V + A + L ++L Sbjct: 423 AIVDAGAITDIVEVLKNGSMEARENAAATLFSLSVIDEN---KVAIGAAGAIQAL--ISL 477 Query: 214 ASDGETHEELLKAMASLTTMLYEQN-SR-VKAVIFDQLKAL 330 +G + A A +Y+ N SR VK I D L L Sbjct: 478 LEEGTRRGKKDAATAIFNLCIYQGNKSRAVKGGIVDPLTRL 518 >At5g03730.2 68418.m00334 serine/threonine protein kinase (CTR1) identical to serine/threonine-protein kinase CTR1 [Arabidopsis thaliana] SWISS-PROT:Q05609 Length = 821 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 246 ESYGFPDDDAIRTEFASKSRDLR 314 ES GFP DD R F DLR Sbjct: 122 ESVGFPQDDGFRLGFGGGGGDLR 144 >At5g03730.1 68418.m00333 serine/threonine protein kinase (CTR1) identical to serine/threonine-protein kinase CTR1 [Arabidopsis thaliana] SWISS-PROT:Q05609 Length = 821 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 246 ESYGFPDDDAIRTEFASKSRDLR 314 ES GFP DD R F DLR Sbjct: 122 ESVGFPQDDGFRLGFGGGGGDLR 144 >At1g51980.1 68414.m05863 mitochondrial processing peptidase alpha subunit, putative similar to mitochondrial processing peptidase alpha subunit, mitochondrial precursor, Alpha-MPP (Ubiquinol-cytochrome C reductase subunit II) [Potato] SWISS-PROT:P29677 Length = 503 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 199 AQLALASDGETHEELLKAMASLTTML 276 A++ LA+ G HEELLK LT+ L Sbjct: 256 ARMVLAASGVEHEELLKVAEPLTSDL 281 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,522,458 Number of Sequences: 28952 Number of extensions: 285494 Number of successful extensions: 907 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 907 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -