BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20753 (722 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0157 + 5083771-5083996,5084007-5084326,5085958-5086392,508... 29 4.9 02_04_0583 + 24078766-24079800,24080585-24081643 28 8.6 >09_02_0157 + 5083771-5083996,5084007-5084326,5085958-5086392, 5087277-5087921 Length = 541 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -1 Query: 494 GITFLDIFLSSFTTEVYLKMKNMS 423 G+T +D FLS F EVY +MK S Sbjct: 77 GVTSMDGFLSMFFPEVYRRMKGTS 100 >02_04_0583 + 24078766-24079800,24080585-24081643 Length = 697 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -1 Query: 401 VLRHYLSLTNLNAEAEKLIQKIKPVTPEQWESKLFL 294 VL +LS L EAE+++QKI+ E E +FL Sbjct: 574 VLLDWLSRLQLVQEAEQVVQKIRKAGEEPLEMHVFL 609 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,300,733 Number of Sequences: 37544 Number of extensions: 244464 Number of successful extensions: 504 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -