BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20753 (722 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC026301-7|AAK68900.2| 1142|Caenorhabditis elegans Hypothetical ... 31 0.63 AF125442-4|AAD12794.1| 317|Caenorhabditis elegans Serpentine re... 29 4.4 AC006684-10|AAF39962.2| 665|Caenorhabditis elegans Hypothetical... 28 5.9 >AC026301-7|AAK68900.2| 1142|Caenorhabditis elegans Hypothetical protein Y54F10BM.9 protein. Length = 1142 Score = 31.5 bits (68), Expect = 0.63 Identities = 16/50 (32%), Positives = 30/50 (60%) Frame = -3 Query: 507 LVECWNNFLGYFSVFIYYRSVFKNEKYVVFRRSVARTATLFVSNKFECRS 358 +++C N +L YF +I+ + F+NE YVV+ S A + +++K R+ Sbjct: 1039 VLKCTNPYLRYFKKYIFLKE-FRNEIYVVYVSSQAVDSGAEITSKNTSRA 1087 >AF125442-4|AAD12794.1| 317|Caenorhabditis elegans Serpentine receptor, class v protein21 protein. Length = 317 Score = 28.7 bits (61), Expect = 4.4 Identities = 8/30 (26%), Positives = 21/30 (70%) Frame = -3 Query: 489 NFLGYFSVFIYYRSVFKNEKYVVFRRSVAR 400 +F+G F++ I+ V++N + ++FR +++ Sbjct: 284 SFIGPFTILIFNNDVYRNVRRMIFRNKISK 313 >AC006684-10|AAF39962.2| 665|Caenorhabditis elegans Hypothetical protein T02H6.2 protein. Length = 665 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -3 Query: 450 SVFKNEKYVVFRRSVARTATLFVSNKFE 367 S+++ EK++ F+ + TL SNK E Sbjct: 236 SIYEKEKFLTFKTDLTAVLTLMTSNKLE 263 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,146,897 Number of Sequences: 27780 Number of extensions: 274940 Number of successful extensions: 628 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 627 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1697838058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -