BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20753 (722 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57260.1 68418.m07152 cytochrome P450 71B10 identical to cyto... 29 4.1 >At5g57260.1 68418.m07152 cytochrome P450 71B10 identical to cytochrome P450 71B10 (SP:Q9LVD2) [Arabidopsis thaliana] Length = 1483 Score = 28.7 bits (61), Expect = 4.1 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 4/76 (5%) Frame = -1 Query: 365 AEAEKLIQKIKPVTPEQWESKLFLFYLFLNLES*CLIIFGIYF----LKRKKIVDILEKV 198 AE EKLI I ++ L +L LN+ C +FG+ F L K D++ + Sbjct: 148 AEMEKLIDSIAESASQKTLVNLSDTFLSLNVNVICKAVFGVNFQGTVLNNDKFQDLVHEA 207 Query: 197 FWVLNNW*ILVFVHYI 150 +L ++ F Y+ Sbjct: 208 LEMLGSFSASDFFPYV 223 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,699,584 Number of Sequences: 28952 Number of extensions: 232914 Number of successful extensions: 484 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 484 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1575119672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -