BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20752 (709 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 24 1.2 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 5.0 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 6.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 6.6 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 21 8.7 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -2 Query: 180 HCTRCLSSGIFVIQ*IFYERRKNYPF 103 HC RC S I + + ++NYP+ Sbjct: 64 HCNRCTSRQIGIANTLIPFMQQNYPY 89 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 Query: 498 NTHSESLKQSQPNTEQKTPVSEDGNVAIGTS 590 +TH + L + T+ K+P S D + TS Sbjct: 72 HTHEKKLVLERSKTKSKSPESRDRSNTSNTS 102 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 6.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -3 Query: 374 TGFTLLCLDKVHPFMFKNSVKSTLFLLQHDQP 279 TG + L + +FK+S +T +LQH P Sbjct: 1239 TGVSTLRGQERQRSLFKDSSPATALMLQHAPP 1270 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 439 PVAGPQLQRPPFETPLVLLETH 504 P PQ PP E PLV ++ H Sbjct: 481 PTLLPQWCLPPREAPLVGVQPH 502 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 21.4 bits (43), Expect = 8.7 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -1 Query: 37 KCVSCMYVCSNK 2 KC C Y C NK Sbjct: 18 KCEKCSYSCVNK 29 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,750 Number of Sequences: 438 Number of extensions: 4762 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -