BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20749 (320 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0043 - 14390398-14391531,14391850-14393691,14393800-143968... 36 0.007 >10_08_0043 - 14390398-14391531,14391850-14393691,14393800-14396825, 14397510-14397609 Length = 2033 Score = 35.9 bits (79), Expect = 0.007 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +2 Query: 152 NHINVSVDTEKLQNCVCNRKINYLSFIKPCQKF-YTNNIVIRIISKIEDSLHY 307 NH++ S++ L+NC+ + K + CQKF N+ +IS+++D Y Sbjct: 1130 NHMSASINVVILENCLADLKDKNVDLFNECQKFAEANHAAEMLISQMKDEARY 1182 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,107,941 Number of Sequences: 37544 Number of extensions: 86680 Number of successful extensions: 107 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 411066120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -