BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20749 (320 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 27 2.8 At1g65900.1 68414.m07478 expressed protein 26 4.9 At1g35470.1 68414.m04400 SPla/RYanodine receptor (SPRY) domain-c... 25 8.6 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 27.1 bits (57), Expect = 2.8 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 6/52 (11%) Frame = +2 Query: 164 VSVDTEKLQNCVCNRKINYL-SFI-----KPCQKFYTNNIVIRIISKIEDSL 301 V +DTEK + KI L +FI +PC +F ++I +IEDSL Sbjct: 117 VKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGALTAKQLIQRIEDSL 168 >At1g65900.1 68414.m07478 expressed protein Length = 408 Score = 26.2 bits (55), Expect = 4.9 Identities = 11/26 (42%), Positives = 20/26 (76%), Gaps = 4/26 (15%) Frame = +2 Query: 254 TNNIVIRIISKIEDS----LHYGRSF 319 +NN+ + IISK+ED+ ++YG++F Sbjct: 29 SNNVKVGIISKVEDATNFHIYYGQTF 54 >At1g35470.1 68414.m04400 SPla/RYanodine receptor (SPRY) domain-containing protein similar to RanBPM [Homo sapiens] GI:15080674; contains Pfam profile PF00622: SPRY domain Length = 465 Score = 25.4 bits (53), Expect = 8.6 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = +2 Query: 173 DTEKLQNCVCNRKINYLSFIKPCQKFYTNNIVIRIISKIEDSLHYGR 313 + +KL + + + F+ CQKF I ++ K+E+ ++YGR Sbjct: 317 ELQKLYPQIVQDDKSVVCFLLHCQKF------IELVGKLEEGVNYGR 357 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,566,197 Number of Sequences: 28952 Number of extensions: 87862 Number of successful extensions: 117 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 350523880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -