BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20746 (778 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 27 0.26 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 24 1.4 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 4.2 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 26.6 bits (56), Expect = 0.26 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 39 KDDDNKRSFCMYVLDPIYKVFDAIMKFKKEEIDDLLKKIGV 161 KD+ NK+ + + +YK+ D I K+EI D+L ++ V Sbjct: 546 KDEANKKGVSLRFYNVVYKLIDNI----KKEIYDILPEVDV 582 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 651 HHFQECPQHEGDEIQCITSRACRC 722 HH P+ G +++ I AC C Sbjct: 464 HHHPHPPETPGPQVETILQNACFC 487 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.6 bits (46), Expect = 4.2 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 370 SPTDDVREQDGADLRQGSFLRLWT 441 SP +D + +D R+GS R W+ Sbjct: 194 SPPNDEGIETDSDRRKGSIARCWS 217 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,374 Number of Sequences: 438 Number of extensions: 5158 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -