BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20745 (717 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 36 4e-04 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 25 0.81 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.7 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 35.5 bits (78), Expect = 4e-04 Identities = 17/61 (27%), Positives = 31/61 (50%) Frame = +3 Query: 492 SHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLA 671 S F++ + RQ+ G+E + + ++H DL N+L + +K+ DFGL+ Sbjct: 582 SFENDFIIQPKHLLSIARQVALGMEHLAKTRVVHRDLAARNVLVC--ENHTVKVSDFGLS 639 Query: 672 R 674 R Sbjct: 640 R 640 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 24.6 bits (51), Expect = 0.81 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 430 DWGKYMCVVLELITGGELFERVI 498 D GKY+CVV + GGE E V+ Sbjct: 301 DSGKYLCVVNNSV-GGESVETVL 322 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.7 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 182 PFPCRDVTIKRNTDVNENYEMLSETDEAN 268 PF C V T N+ M+S DE++ Sbjct: 201 PFACTHVIYAFATIDPHNFNMISNDDESD 229 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,239 Number of Sequences: 336 Number of extensions: 3406 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -