BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20745 (717 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17) 80 2e-15 SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_40655| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_37321| Best HMM Match : Pkinase (HMM E-Value=2.4e-27) 66 3e-11 SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_8354| Best HMM Match : Pkinase (HMM E-Value=6.3e-15) 55 5e-08 SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) 54 2e-07 SB_46550| Best HMM Match : Asn_synthase (HMM E-Value=0) 53 2e-07 SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) 53 3e-07 SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_40595| Best HMM Match : Pkinase (HMM E-Value=3.4e-08) 52 6e-07 SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) 52 6e-07 SB_16221| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_20713| Best HMM Match : Pkinase (HMM E-Value=0) 51 1e-06 SB_18577| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) 50 2e-06 SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19) 49 3e-06 SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) 49 4e-06 SB_57461| Best HMM Match : Pkinase (HMM E-Value=1.1e-34) 49 4e-06 SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_31697| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_33829| Best HMM Match : Pkinase (HMM E-Value=0) 47 1e-05 SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) 47 1e-05 SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) 46 2e-05 SB_51866| Best HMM Match : Pkinase (HMM E-Value=0) 46 2e-05 SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) 46 4e-05 SB_30262| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) 45 5e-05 SB_3002| Best HMM Match : Pkinase (HMM E-Value=4.1e-17) 45 5e-05 SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) 45 7e-05 SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 44 9e-05 SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) 44 1e-04 SB_53116| Best HMM Match : Pkinase (HMM E-Value=1.9e-09) 44 1e-04 SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) 44 1e-04 SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26) 44 2e-04 SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22) 44 2e-04 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 44 2e-04 SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) 44 2e-04 SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_3250| Best HMM Match : Pkinase (HMM E-Value=1e-09) 43 2e-04 SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) 43 2e-04 SB_45| Best HMM Match : Pkinase (HMM E-Value=0) 43 2e-04 SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) 43 3e-04 SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_18517| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_53036| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) 42 5e-04 SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 42 5e-04 SB_6592| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_2079| Best HMM Match : Pkinase (HMM E-Value=4.2e-10) 42 7e-04 SB_12392| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7625| Best HMM Match : Pkinase (HMM E-Value=6.8e-10) 41 0.001 SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) 40 0.002 SB_12792| Best HMM Match : Pkinase (HMM E-Value=1.1e-09) 40 0.002 SB_11943| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 40 0.002 SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_43344| Best HMM Match : Pkinase (HMM E-Value=6.9e-08) 40 0.002 SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) 40 0.002 SB_21166| Best HMM Match : Pkinase (HMM E-Value=0) 40 0.002 SB_33663| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 40 0.003 SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) 40 0.003 SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 39 0.004 SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) 39 0.004 SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) 39 0.004 SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_24478| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 38 0.006 SB_21129| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) 38 0.008 SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_43870| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 38 0.008 SB_25445| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_20165| Best HMM Match : Pkinase (HMM E-Value=0.00013) 38 0.008 SB_33662| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_11865| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.7e-07) 38 0.011 SB_34306| Best HMM Match : Pkinase (HMM E-Value=0) 37 0.014 SB_8553| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_22843| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_22496| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_19615| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_18146| Best HMM Match : Pkinase (HMM E-Value=0) 37 0.019 SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) 37 0.019 SB_13922| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) 37 0.019 SB_36849| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33962| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_42680| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 36 0.025 SB_39043| Best HMM Match : Pkinase (HMM E-Value=2.7e-09) 36 0.025 SB_33824| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) 36 0.025 SB_24175| Best HMM Match : Pkinase (HMM E-Value=6.2e-07) 36 0.025 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 36 0.025 SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20) 36 0.025 SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.033 SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_37647| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_25981| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.057 SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10) 35 0.057 SB_19466| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.057 SB_6977| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.057 SB_31555| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 35 0.076 SB_18697| Best HMM Match : Pkinase (HMM E-Value=5.9e-07) 35 0.076 SB_16900| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_57764| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_42485| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 34 0.10 SB_22527| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_9759| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 34 0.10 SB_14773| Best HMM Match : Pkinase (HMM E-Value=1.1e-05) 34 0.13 SB_26437| Best HMM Match : Pkinase (HMM E-Value=3.6e-36) 34 0.13 SB_39694| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 33 0.18 SB_26513| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_14271| Best HMM Match : Pkinase (HMM E-Value=2.1e-27) 33 0.18 SB_4877| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) 33 0.18 SB_47579| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) 33 0.23 SB_41626| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_11148| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 33 0.23 SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) 33 0.31 SB_9807| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.00031) 33 0.31 SB_55249| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_42486| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 32 0.40 SB_37572| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 32 0.40 SB_21044| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 32 0.40 SB_52903| Best HMM Match : DUF1126 (HMM E-Value=0) 32 0.53 SB_37607| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-23) 32 0.53 SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) 32 0.53 SB_3163| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_26337| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-21) 32 0.53 SB_9978| Best HMM Match : Pkinase (HMM E-Value=3.4e-17) 32 0.53 SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10) 31 0.71 SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_26242| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.8e-15) 31 0.93 SB_19037| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_1550| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 31 0.93 SB_28925| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 31 0.93 SB_27024| Best HMM Match : Pkinase (HMM E-Value=4.7e-25) 31 1.2 SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) 31 1.2 SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) 31 1.2 SB_23400| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_51639| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 30 2.2 SB_26833| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_22903| Best HMM Match : 7tm_1 (HMM E-Value=3.2e-05) 30 2.2 SB_18047| Best HMM Match : Pkinase (HMM E-Value=2.1e-07) 30 2.2 SB_45888| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.4e-25) 30 2.2 SB_25669| Best HMM Match : LRR_1 (HMM E-Value=9.1e-33) 30 2.2 SB_23777| Best HMM Match : Pkinase (HMM E-Value=0.065) 30 2.2 SB_18432| Best HMM Match : VirB3 (HMM E-Value=6.3) 30 2.2 SB_17071| Best HMM Match : Pkinase (HMM E-Value=0.065) 30 2.2 SB_11275| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.0005) 30 2.2 SB_10367| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_51537| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_46446| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_35734| Best HMM Match : Extensin_2 (HMM E-Value=0.52) 29 2.8 SB_33716| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_58584| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_40578| Best HMM Match : Pkinase (HMM E-Value=2.2e-11) 29 5.0 SB_31810| Best HMM Match : Pkinase (HMM E-Value=0.17) 29 5.0 SB_56812| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-06) 28 6.6 SB_55598| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_26356| Best HMM Match : Pkinase (HMM E-Value=0.00044) 28 6.6 SB_6695| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_51259| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.4e-08) 28 6.6 SB_40460| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_51468| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) 28 8.7 SB_28361| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 8.7 >SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17) Length = 181 Score = 79.8 bits (188), Expect = 2e-15 Identities = 36/68 (52%), Positives = 49/68 (72%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEK 692 LTE+ +M Q+ +GIE VH++N+LHLDLKPENI+C++K IK+IDFGLA+ Y Sbjct: 93 LTEKEAAYYMHQLLQGIEHVHKKNVLHLDLKPENIVCVSKDSWDIKLIDFGLAQEYKEGF 152 Query: 693 KLQVLFGT 716 K+ L GT Sbjct: 153 KMTALKGT 160 Score = 58.4 bits (135), Expect = 5e-09 Identities = 33/86 (38%), Positives = 43/86 (50%), Gaps = 3/86 (3%) Frame = +1 Query: 259 RGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXXL---RHPRLIQLYDAY 429 RGKFG V +K TG AAK + H RL+ L DAY Sbjct: 6 RGKFGVVKRVTDKKTGTVYAAKYIKTSGALSGSSRDDVMREIDIMSRMHHKRLVGLLDAY 65 Query: 430 DWGKYMCVVLELITGGELFERVIDED 507 D + + +++E I+GGELFERV+DED Sbjct: 66 DANRNIVMIMEFISGGELFERVVDED 91 >SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 72.5 bits (170), Expect = 3e-13 Identities = 32/70 (45%), Positives = 50/70 (71%), Gaps = 2/70 (2%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNR--IKIIDFGLARFYDP 686 LTE+ +MRQI +G+E +HR++I+HLDLKPEN+LC+ + + +K+IDFG+A + Sbjct: 145 LTEKEVIRYMRQILQGVEHMHRKSIVHLDLKPENVLCVIRPDGKEDLKLIDFGMAHIIEK 204 Query: 687 EKKLQVLFGT 716 K L++ GT Sbjct: 205 GKDLKLACGT 214 Score = 51.6 bits (118), Expect = 6e-07 Identities = 30/84 (35%), Positives = 43/84 (51%) Frame = +1 Query: 259 RGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXXLRHPRLIQLYDAYDWG 438 +GKFG V ++K TG LAAK L RLI L DAY+ Sbjct: 62 KGKFGVVKKVKDKKTGEVLAAKFIRTSSESKKEVMGEIAMMNH-LHSKRLIYLADAYERP 120 Query: 439 KYMCVVLELITGGELFERVIDEDS 510 M V++E ++GGELFE++ ++D+ Sbjct: 121 GEMIVIMEFVSGGELFEKICNDDN 144 >SB_40655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1074 Score = 68.5 bits (160), Expect = 5e-12 Identities = 32/81 (39%), Positives = 51/81 (62%) Frame = +3 Query: 474 RRAVRKSHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKI 653 RR +R +HR +L C + ++++H NI+HLDLKPENI+C + N+IK+ Sbjct: 433 RRVIRTNHRGG-LLDGGRCDLLCAPSPTALDYMHGNNIVHLDLKPENIMCESINSNQIKL 491 Query: 654 IDFGLARFYDPEKKLQVLFGT 716 +DFGLAR +++++ FGT Sbjct: 492 VDFGLARELKKDEEVKSSFGT 512 >SB_37321| Best HMM Match : Pkinase (HMM E-Value=2.4e-27) Length = 592 Score = 66.1 bits (154), Expect = 3e-11 Identities = 32/68 (47%), Positives = 46/68 (67%), Gaps = 1/68 (1%) Frame = +3 Query: 516 TERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLT-KTGNRIKIIDFGLARFYDPEK 692 +E+ +RQI EGI +H+QN +HLD+KP NIL +T + IKIIDFGLAR P + Sbjct: 250 SEKEVVYLLRQILEGIRHLHKQNYVHLDIKPNNILLMTDEIYPEIKIIDFGLARRIKPGE 309 Query: 693 KLQVLFGT 716 ++ ++ GT Sbjct: 310 QICLIVGT 317 Score = 38.3 bits (85), Expect = 0.006 Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 6/91 (6%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXX------LRHPRLIQL 417 GRG++ V K+TGLE AAK +H ++IQL Sbjct: 152 GRGQYAVVRRVTHKTTGLEYAAKFVRKRRKGQDCRSEVWHEVEVLWSTNHPYQHTKIIQL 211 Query: 418 YDAYDWGKYMCVVLELITGGELFERVIDEDS 510 ++ Y+ + +VLEL GG+L + DS Sbjct: 212 HEVYETRTELILVLELALGGDLHRHCVALDS 242 >SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 58.4 bits (135), Expect = 5e-09 Identities = 27/83 (32%), Positives = 40/83 (48%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXXLRHPRLIQLYDAYDW 435 G G F V+ C E+ TGLE AAK LRH ++ LY + Sbjct: 38 GEGSFAKVFRCIERKTGLEFAAKELRLTDVEDKEKIEQEIAVWKDLRHENIVSLYSSIRE 97 Query: 436 GKYMCVVLELITGGELFERVIDE 504 G+ +C+++E + GG LF+ VI + Sbjct: 98 GETVCLIMEYVAGGSLFDEVIQQ 120 Score = 48.0 bits (109), Expect = 8e-06 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 2/55 (3%) Frame = +3 Query: 516 TERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNR--IKIIDFGLAR 674 +E+ + RQ+ +E++H + I+H D+KP+N+L L + GN IK+ DFGLA+ Sbjct: 124 SEKQARLVTRQLLNALEYLHSRRIVHRDIKPDNLL-LKRIGNNVTIKLADFGLAQ 177 >SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 56.0 bits (129), Expect = 3e-08 Identities = 27/68 (39%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Frame = +3 Query: 471 GRRAVRKSHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTG-NRI 647 G ++ +R+F TE+ ++ + IC ++F+H+Q I H DLKPENILC + + + Sbjct: 177 GGPLLKHIEKRKF-FTEKEASLVVNDICSALDFLHKQGIAHRDLKPENILCSHENKVSPV 235 Query: 648 KIIDFGLA 671 KI DF LA Sbjct: 236 KICDFDLA 243 >SB_8354| Best HMM Match : Pkinase (HMM E-Value=6.3e-15) Length = 280 Score = 55.2 bits (127), Expect = 5e-08 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPE 689 F+ QI G++++H N+LH DLKP N+L T +KI DFGLAR DP+ Sbjct: 18 FLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCD--LKICDFGLARIADPD 66 >SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 622 Score = 54.8 bits (126), Expect = 7e-08 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = +3 Query: 507 FVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNR-IKIIDFGLARFYD 683 FV +E + +MRQ+ E + F H I+H DLKP N+L + + IK+ DFG+A Sbjct: 18 FVYSEAVASHYMRQVLEAVSFCHENGIIHRDLKPHNVLLANRENSAPIKVADFGVAVELP 77 Query: 684 PE 689 PE Sbjct: 78 PE 79 >SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) Length = 226 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFY 680 QI G++F+H I+H D+KP+NIL +TK G ++KI DFGLAR Y Sbjct: 121 QILNGVDFLHTHRIVHRDIKPQNIL-VTKDG-QVKIADFGLARVY 163 >SB_46550| Best HMM Match : Asn_synthase (HMM E-Value=0) Length = 1663 Score = 53.2 bits (122), Expect = 2e-07 Identities = 31/85 (36%), Positives = 40/85 (47%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXXLRHPRLIQLYDAYDW 435 GRG++ V C EKSTG E AAK L+HP L DAYD Sbjct: 1100 GRGRYAVVKKCVEKSTGKEFAAKMVKKRMLDPVDIDREVTVLRM-LKHPNLCIFLDAYDT 1158 Query: 436 GKYMCVVLELITGGELFERVIDEDS 510 K +V EL+ GG LF+ ++ D+ Sbjct: 1159 PKNYIIVTELLAGGRLFDYLVVMDA 1183 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLK 605 LTE+ +M Q+ EG++ +H NI+HLDLK Sbjct: 1184 LTEKVAIGYMHQVVEGVQHLHDLNIVHLDLK 1214 >SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) Length = 870 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/54 (48%), Positives = 36/54 (66%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 L E M Q+ IEF+HR NI+H D+KPENIL ++++G +K+ DFG AR Sbjct: 42 LDENTVRKVMWQVLRAIEFIHRHNIIHRDVKPENIL-VSRSG-IVKLCDFGFAR 93 >SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 52.8 bits (121), Expect = 3e-07 Identities = 28/81 (34%), Positives = 45/81 (55%) Frame = +3 Query: 474 RRAVRKSHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKI 653 RR++ + H+RR LTE FM+QI + ++H+ I+H DLK N+ +K+ Sbjct: 122 RRSLMELHKRRRALTEPEVRYFMKQIIDACIYLHKSRIIHRDLKLGNL--FLNDDMEVKV 179 Query: 654 IDFGLARFYDPEKKLQVLFGT 716 DFGLA + ++ + L GT Sbjct: 180 GDFGLATRAEEGERKKTLCGT 200 >SB_40595| Best HMM Match : Pkinase (HMM E-Value=3.4e-08) Length = 335 Score = 51.6 bits (118), Expect = 6e-07 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILC-LTKTGNRIKIIDFGLARFY-DP 686 Q IE+VH +N +H D+KP+N L L K GN + IIDFGLA+ Y DP Sbjct: 74 QTISRIEYVHSKNFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKYRDP 122 >SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) Length = 428 Score = 51.6 bits (118), Expect = 6e-07 Identities = 28/83 (33%), Positives = 45/83 (54%) Frame = +3 Query: 468 NGRRAVRKSHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRI 647 +G+ K+ + L E+ F +QI G+++ HR ++H DLKPEN+L ++ I Sbjct: 112 HGKVQCDKTSHFKVQLEEKDARRFFQQIISGVDYCHRHMVVHRDLKPENLLLDSQL--NI 169 Query: 648 KIIDFGLARFYDPEKKLQVLFGT 716 KI DFGL+ + LQ G+ Sbjct: 170 KIADFGLSNIMTDGEFLQTSCGS 192 Score = 37.9 bits (84), Expect = 0.008 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 3/84 (3%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXXL---RHPRLIQLYDA 426 G G FG V L + TG ++A K L RHP +I+LY Sbjct: 27 GVGTFGKVKLAVHQLTGHKVAIKILNRNKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQV 86 Query: 427 YDWGKYMCVVLELITGGELFERVI 498 + +V+E ++GGELFE ++ Sbjct: 87 ISTPTDIFMVMEYVSGGELFEYIL 110 >SB_16221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 834 Score = 51.6 bits (118), Expect = 6e-07 Identities = 24/68 (35%), Positives = 38/68 (55%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEK 692 L E F RQI I++ H+ +++H DLKPEN++ K + K+ DFG + + P + Sbjct: 12 LPEEKARYFFRQIVLAIDYCHKLHVVHRDLKPENVI-FFKNQDMAKLTDFGFSNNFIPNE 70 Query: 693 KLQVLFGT 716 KL G+ Sbjct: 71 KLDTACGS 78 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 50.8 bits (116), Expect = 1e-06 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = +3 Query: 510 VLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNR-IKIIDFGLAR 674 +L E + QI +G+ F+H+ H D+KPEN+LC TG+ +KI DFGLAR Sbjct: 62 LLPESVIRNVIYQILQGLAFIHKHGYFHRDMKPENLLC---TGHELVKIADFGLAR 114 >SB_20713| Best HMM Match : Pkinase (HMM E-Value=0) Length = 492 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/52 (42%), Positives = 35/52 (67%) Frame = +3 Query: 534 VFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPE 689 +F+ Q+ G++++H N+LH D+KP N+L ++T +KI DFG R DPE Sbjct: 127 LFLYQLLRGLKYIHSANVLHRDIKPSNLLVDSET-LMLKIGDFGQTRVVDPE 177 >SB_18577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 50.4 bits (115), Expect = 1e-06 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 4/57 (7%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLTKTGNR---IKIIDFGLARFY-DPEKKLQV 704 Q+ IE+VH +N+++ D+KPEN L K+ + I IIDFGLA+ Y DPE K + Sbjct: 148 QLISRIEYVHSKNMIYRDIKPENFLIGRKSAGKEKTINIIDFGLAKEYIDPETKKHI 204 >SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 50.0 bits (114), Expect = 2e-06 Identities = 27/68 (39%), Positives = 39/68 (57%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEK 692 L+E +RQI + +H Q I+H DLK ENIL L ++ IKI+DFGL+ Y + Sbjct: 113 LSETQARPIVRQIVSALHHLHEQGIVHRDLKMENIL-LDESKKTIKIVDFGLSNKYSGGE 171 Query: 693 KLQVLFGT 716 L+ G+ Sbjct: 172 LLKTQCGS 179 Score = 31.1 bits (67), Expect = 0.93 Identities = 21/79 (26%), Positives = 31/79 (39%), Gaps = 3/79 (3%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXXLR---HPRLIQLYDA 426 G+G F V L + T ++A K L+ HP +++LY+ Sbjct: 23 GKGNFAFVELAFNRVTKSKVAVKVIDTRKIKDDYVKRNILREALLLKRAHHPNIVKLYET 82 Query: 427 YDWGKYMCVVLELITGGEL 483 C+V E I GGEL Sbjct: 83 LKQRGVYCLVTEYIPGGEL 101 >SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) Length = 323 Score = 49.6 bits (113), Expect = 2e-06 Identities = 29/59 (49%), Positives = 36/59 (61%) Frame = +3 Query: 498 RRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 R LTE+A RQI G+ ++H Q+I+H DLK EN+L L K N I I DFG AR Sbjct: 142 RTHGALTEKASRRLFRQITAGVHYIHSQDIVHRDLKCENLL-LDKDLN-IIISDFGFAR 198 >SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19) Length = 284 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/60 (40%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +3 Query: 498 RRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNR-IKIIDFGLAR 674 +RRF TE+ F ++I + + H N+ H DLKPEN+L + K+ N +K+ DFG A+ Sbjct: 13 KRRF--TEKEAMKFTKEIAQALYHCHSFNVAHRDLKPENLLLVDKSENLVVKLADFGFAK 70 >SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 920 Score = 48.8 bits (111), Expect = 4e-06 Identities = 30/92 (32%), Positives = 46/92 (50%) Frame = +3 Query: 441 IYVRRT*TNNGRRAVRKSHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 620 +Y+ NNG +H R L E+ QI +++ H+++++H DLK EN+L Sbjct: 229 LYLVTDYANNGEMFDYLAHHGR--LPEKEARKKFVQILSAVDYCHKRHVVHRDLKAENLL 286 Query: 621 CLTKTGNRIKIIDFGLARFYDPEKKLQVLFGT 716 L + N IKI DFG +Y P L G+ Sbjct: 287 -LDQNMN-IKIADFGFGNYYKPGNPLNTWCGS 316 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/80 (22%), Positives = 32/80 (40%), Gaps = 2/80 (2%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXX--LRHPRLIQLYDAY 429 G+G F V L R + T ++A K L+HP +++LY Sbjct: 164 GKGNFSVVKLARHRITKSQVAIKIIDKTQLNEMNLKKIYREVQIMKLLQHPHIVKLYQVM 223 Query: 430 DWGKYMCVVLELITGGELFE 489 + + +V + GE+F+ Sbjct: 224 ETKNMLYLVTDYANNGEMFD 243 >SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) Length = 759 Score = 48.8 bits (111), Expect = 4e-06 Identities = 20/54 (37%), Positives = 35/54 (64%), Gaps = 2/54 (3%) Frame = +3 Query: 516 TERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNR--IKIIDFGLA 671 TE + R +C+ + ++H++ I+H DLKPEN+L ++ + +K+ DFGLA Sbjct: 541 TEHVAKSYFRDMCKALAYLHKRKIVHRDLKPENLLVHKRSDGQTHLKLADFGLA 594 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/87 (28%), Positives = 38/87 (43%), Gaps = 1/87 (1%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXX-LRHPRLIQLYDAYD 432 G G F V C++K T E A K RHP +++L++ YD Sbjct: 454 GDGNFAIVRQCKDKITQKEFAIKIIDKRKIRGKEKMIDDEIAIMRRCRHPNIVRLFEDYD 513 Query: 433 WGKYMCVVLELITGGELFERVIDEDSF 513 + +V+ELI GG+LF+ + F Sbjct: 514 SATEIYLVMELIKGGDLFDAISSSVKF 540 >SB_57461| Best HMM Match : Pkinase (HMM E-Value=1.1e-34) Length = 355 Score = 48.8 bits (111), Expect = 4e-06 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = +3 Query: 501 RRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILC-LTKTGNRIKIIDFGLARF 677 RRF T + + Q+ IE+VH +N +H D+KP+N L + K N++ +IDFGLA+ Sbjct: 108 RRF--TMKTVLMLADQMISRIEYVHNKNFIHRDIKPDNFLMGVGKHCNKLFLIDFGLAKK 165 Query: 678 YDPEKKLQ 701 Y + Q Sbjct: 166 YRDSRTRQ 173 >SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 48.0 bits (109), Expect = 8e-06 Identities = 23/48 (47%), Positives = 30/48 (62%) Frame = +3 Query: 540 MRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYD 683 +R+I EG+ +H Q I+H DLKP NI G IK+ DFGLA +D Sbjct: 1080 LREIVEGLAHIHSQGIIHRDLKPVNI--FLDAGGHIKLGDFGLATTHD 1125 >SB_31697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 2/77 (2%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXXLRHPRLIQLYDAYDW 435 G+G+FG V C K TG + AAK +RH RL++L DA++ Sbjct: 165 GKGRFGVVCKCVNKKTGKQFAAKFIKCSKPQDREDVIHEMEIMNTIRHKRLLRLADAFET 224 Query: 436 --GKYMCVVLELITGGE 480 + M +V+EL+TGG+ Sbjct: 225 PSQQEMILVMELVTGGD 241 >SB_33829| Best HMM Match : Pkinase (HMM E-Value=0) Length = 290 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/59 (38%), Positives = 33/59 (55%) Frame = +3 Query: 498 RRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 R + E +F Q+ + +E++H + ++H DLK ENI L NRI I DFG AR Sbjct: 82 RSNGAIPENEARLFYHQLVDAVEYLHNKGVVHRDLKCENI--LLNRDNRILISDFGFAR 138 >SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) Length = 937 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/68 (32%), Positives = 36/68 (52%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEK 692 + E+ RQI +++ H+++++H DLK EN+ L IKI DFG + + P Sbjct: 177 MKEKEARAKFRQIVSAVQYCHQKHVIHRDLKAENL--LLDADMNIKIADFGFSNEFTPGN 234 Query: 693 KLQVLFGT 716 KL G+ Sbjct: 235 KLDTFCGS 242 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 2/83 (2%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXX--LRHPRLIQLYDAY 429 G+G F V L + TG E+A K L HP +++LY+ Sbjct: 90 GKGNFAKVKLAKHVPTGKEVAIKIIDKTQLNPSSLQKLFREVRIMKFLDHPNIVKLYEVI 149 Query: 430 DWGKYMCVVLELITGGELFERVI 498 + K + +V+E +GGE+F+ ++ Sbjct: 150 ETDKTLYLVMEYASGGEVFDYLV 172 >SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) Length = 834 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILC-LTKTGNRIKIIDFGLARFYDPEKKLQ 701 Q+ IE+VH +N +H D+KP+N L + + N++ +IDFGLA+ Y + Q Sbjct: 116 QMIARIEYVHNKNFIHRDIKPDNFLMGIGRHCNKLYLIDFGLAKKYRDSRTKQ 168 >SB_51866| Best HMM Match : Pkinase (HMM E-Value=0) Length = 948 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/54 (40%), Positives = 31/54 (57%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 LT F+ QI G++++H +LH DLKP N+ L +KI DFG+AR Sbjct: 122 LTTEHVRYFLYQILRGLKYIHSAKVLHRDLKPSNL--LVNENAELKIGDFGMAR 173 >SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/48 (43%), Positives = 32/48 (66%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFY 680 ++ Q+ G+ + H +LH DLKP+N+L + K G IK+ DFGLAR + Sbjct: 73 YVYQLLSGVAYCHSHRVLHRDLKPQNLL-IDKNG-AIKLADFGLARAF 118 >SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 727 Score = 46.0 bits (104), Expect = 3e-05 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 3/70 (4%) Frame = +3 Query: 516 TERACTVFMRQICEGIEFVHRQNILHLDLKPENILCL-TKTGNRIKIIDFGLA--RFYDP 686 TER T + + EG+ ++H I H DLKPEN+L ++I I DFGL+ R + Sbjct: 163 TERDATRVIYMVLEGVRYLHSLGITHRDLKPENLLYYHPGNDSKIMITDFGLSNLRKHPD 222 Query: 687 EKKLQVLFGT 716 ++ ++ GT Sbjct: 223 DRTMETTCGT 232 Score = 33.5 bits (73), Expect = 0.18 Identities = 12/41 (29%), Positives = 27/41 (65%) Frame = +1 Query: 391 LRHPRLIQLYDAYDWGKYMCVVLELITGGELFERVIDEDSF 513 ++H +++LY+ ++ + +V+EL TGG L +R++ + F Sbjct: 122 VKHEFVVRLYEVFECKNRVYLVMELATGGVLLDRILSKGFF 162 >SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) Length = 967 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/45 (42%), Positives = 30/45 (66%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLA 671 ++RQI +G+ ++H ++H D+K NIL + TG I+I DFG A Sbjct: 720 YLRQILQGVSYLHENQVVHRDIKGANIL-VDSTGQDIRIADFGAA 763 >SB_30262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 45.2 bits (102), Expect = 5e-05 Identities = 17/39 (43%), Positives = 29/39 (74%) Frame = +3 Query: 498 RRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPEN 614 R++ + TE A +V MR+I +EF+H++ ++H DLKPE+ Sbjct: 360 RKKKMFTESAASVIMRKIVSAVEFMHQRGVVHRDLKPES 398 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +1 Query: 406 LIQLYDAYDWGKYMCVVLELITGGELFERVIDEDSF*QSA 525 L+ +++ Y+ V+EL+ GGEL ER+ + F +SA Sbjct: 332 LVDYASMFEFHTYL--VMELLAGGELLERIRKKKMFTESA 369 >SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) Length = 235 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/54 (38%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Frame = +3 Query: 516 TERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLT-KTGNRIKIIDFGLAR 674 TE+ + ++QI E +++H I+H DLKPEN+L + ++I I DFGL++ Sbjct: 107 TEQDASALVQQILEAADYLHSLGIVHRDLKPENLLYYSPDEDSKIMISDFGLSK 160 >SB_3002| Best HMM Match : Pkinase (HMM E-Value=4.1e-17) Length = 683 Score = 45.2 bits (102), Expect = 5e-05 Identities = 26/59 (44%), Positives = 36/59 (61%) Frame = +3 Query: 540 MRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEKKLQVLFGT 716 M I E ++++H N++H DLKPENIL L + N +KI DFG A + L+ L GT Sbjct: 601 MLSIFEAVDYMHYHNVVHRDLKPENIL-LDEEIN-VKISDFGFAVELKEGETLRELCGT 657 >SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 44.8 bits (101), Expect = 7e-05 Identities = 24/59 (40%), Positives = 34/59 (57%) Frame = +3 Query: 504 RFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFY 680 R +L + ++ QI I F H + ILH DLKP+N+L +K IK+ DFGL R + Sbjct: 203 RGMLDKTLVKSYLYQITNAIYFCHARRILHRDLKPQNLLIDSK--GLIKLADFGLGRAF 259 >SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 44.8 bits (101), Expect = 7e-05 Identities = 21/54 (38%), Positives = 34/54 (62%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 +TE + +R I + ++H NI+HLD++P NI+ G+ +K+IDFG AR Sbjct: 141 VTEEDAALVIRGILNALCYLHELNIVHLDIRPANIMV---QGSDVKLIDFGNAR 191 >SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) Length = 228 Score = 44.8 bits (101), Expect = 7e-05 Identities = 23/53 (43%), Positives = 32/53 (60%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLA 671 L E ++ QI +G+ F+H NI+H DLK NIL L K +K+ DFG+A Sbjct: 26 LVEETVRQYVWQILKGLSFLHGVNIIHRDLKGANIL-LDKEKRFLKLTDFGIA 77 >SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 44.8 bits (101), Expect = 7e-05 Identities = 29/96 (30%), Positives = 43/96 (44%), Gaps = 4/96 (4%) Frame = +1 Query: 259 RGKFGTVYLCREKST----GLELAAKXXXXXXXXXXXXXXXXXXXXXXLRHPRLIQLYDA 426 RG FG V L K T ++L +K L HP +I++ D Sbjct: 58 RGAFGEVRLAFTKGTCHKFAVKLISKRQFSVSPVSHASIKDEVNILKALNHPCIIEIADV 117 Query: 427 YDWGKYMCVVLELITGGELFERVIDEDSF*QSAPVL 534 ++ + +VLEL+ GGELF+RV+ F +S L Sbjct: 118 FESPDMLYIVLELVEGGELFDRVVSVKRFEESVAKL 153 >SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) Length = 783 Score = 44.4 bits (100), Expect = 9e-05 Identities = 17/33 (51%), Positives = 25/33 (75%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPE 611 LTE+ +M Q+ +GIE VH++N+LHLDLK + Sbjct: 154 LTEKEAAYYMHQLLQGIEHVHKKNVLHLDLKKQ 186 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/37 (37%), Positives = 25/37 (67%) Frame = +3 Query: 606 PENILCLTKTGNRIKIIDFGLARFYDPEKKLQVLFGT 716 P+N++ + G+R+KIIDF L R Y+ + ++ +GT Sbjct: 645 PQNVMFKREGGSRVKIIDFSLTRKYNTKVDTKISYGT 681 Score = 35.1 bits (77), Expect = 0.057 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 3/73 (4%) Frame = +1 Query: 259 RGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXXL---RHPRLIQLYDAY 429 RGKFG V +K TG AAK + H RL+ L DAY Sbjct: 6 RGKFGVVKRVTDKKTGTVYAAKYIKTSGALSGSSRDDVMREIDIMSRMHHKRLVGLLDAY 65 Query: 430 DWGKYMCVVLELI 468 D + + +++ELI Sbjct: 66 DANRNIVMIMELI 78 Score = 33.5 bits (73), Expect = 0.18 Identities = 20/69 (28%), Positives = 29/69 (42%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXXLRHPRLIQLYDAYDW 435 GRG+FG V C T + AK LRHP L ++ DA+D Sbjct: 460 GRGRFGVVRKCVHLKTAVHFVAKSIKARPSQKEEFSREIDVMNE-LRHPNLSRIRDAFDK 518 Query: 436 GKYMCVVLE 462 + + +V+E Sbjct: 519 PREIIIVME 527 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = +1 Query: 466 ITGGELFERVIDED 507 I+GGELFERV+DED Sbjct: 139 ISGGELFERVVDED 152 >SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) Length = 1023 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 1/82 (1%) Frame = +3 Query: 474 RRAVRKSHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKI 653 R+++ + + R LTE FM+Q E ++H Q ++H D+K N + +++ Sbjct: 515 RKSLVQMLKTRGKLTEPEVRFFMQQAIEACSYLHEQRVIHRDIKVGNF--FINSNMELRL 572 Query: 654 IDFGLA-RFYDPEKKLQVLFGT 716 DFGLA R E K++ + GT Sbjct: 573 GDFGLAVRLKPDEYKIRTMCGT 594 >SB_53116| Best HMM Match : Pkinase (HMM E-Value=1.9e-09) Length = 481 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCL--TKTGNRIKIIDFGLARFYDPEKK 695 QI +GI ++H +LH DLKP NIL + R+KI D G AR ++ K Sbjct: 29 QILDGIHYLHSNWVLHRDLKPANILVMGDGPERGRVKIADMGFARLFNAPLK 80 >SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) Length = 322 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/65 (33%), Positives = 39/65 (60%) Frame = +3 Query: 519 ERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEKKL 698 E+ ++RQ+ + + + H + ++H D+KPEN+L L G+ IKI DFG + + P + Sbjct: 126 EKRAAKYIRQLADALAYCHSKKVIHRDIKPENLL-LNYKGD-IKIADFGWS-VHAPSSRY 182 Query: 699 QVLFG 713 +L G Sbjct: 183 PLLQG 187 >SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 2/54 (3%) Frame = +3 Query: 516 TERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNR--IKIIDFGLA 671 TE + +R + ++++H +I+H D+KPEN+L L R +K+ DFGLA Sbjct: 114 TEVHASHMVRDLASALDYLHCNSIVHRDIKPENLLVLNLPNGRKSLKLADFGLA 167 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/87 (22%), Positives = 39/87 (44%), Gaps = 1/87 (1%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXX-LRHPRLIQLYDAYD 432 G G F V C+ + T E A K ++H +++L + Y+ Sbjct: 27 GDGNFAVVRECKHRKTNKEYALKIINKAKVKGKEHMIENEISILRRVKHNHIVELIEEYE 86 Query: 433 WGKYMCVVLELITGGELFERVIDEDSF 513 + + +V+EL+ GG+LFE +++ + Sbjct: 87 TPREIFLVMELVKGGDLFEAIVEATKY 113 >SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26) Length = 239 Score = 43.6 bits (98), Expect = 2e-04 Identities = 26/74 (35%), Positives = 38/74 (51%), Gaps = 14/74 (18%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILC--------------LTKTGNRIK 650 LTE F+RQ+ +G+ + H++N LH D+K NIL L IK Sbjct: 82 LTEDHIKSFIRQLLDGLNYCHKKNFLHRDIKCSNILLNNNFYSQYKDQLFDLFVPRGEIK 141 Query: 651 IIDFGLARFYDPEK 692 + DFGLAR Y+ ++ Sbjct: 142 LADFGLARLYEADE 155 >SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/53 (39%), Positives = 32/53 (60%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLA 671 L E RQ+ EG++F+H ++H DLK N+L L GN +K+ DFG++ Sbjct: 326 LNEPEIRAVTRQLFEGLQFLHNHKVIHRDLKAGNLL-LASDGN-VKMADFGVS 376 >SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22) Length = 331 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTK-TGNRI-KIIDFGLARFYDP 686 L+E+ C +R + G++ +H I+H DLKP NI+ + + G+ + K+ DFG AR Sbjct: 109 LSEQDCIAVIRDVVAGMKHLHDNGIVHRDLKPGNIMRVYRDDGSCVYKLTDFGAARELME 168 Query: 687 EKKLQVLFGT 716 + ++GT Sbjct: 169 SDQFVSIYGT 178 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/46 (39%), Positives = 30/46 (65%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 + RQI +G+ ++H N++H D+K NI+ + IK+IDFG A+ Sbjct: 284 YTRQILDGVSYLHNNNVIHRDIKGGNIMLM--PNGVIKLIDFGCAK 327 >SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) Length = 476 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +3 Query: 540 MRQICEGIEFVHRQNILHLDLKPENILCLTK-TGNRIKIIDFGLARFYDPEK 692 ++Q+ ++ H I+H DLKPEN+L ++ G +K+ DFGLA D E+ Sbjct: 120 IQQVLLSVQHCHENGIVHRDLKPENLLLASRERGAMVKLADFGLAIEVDGER 171 Score = 41.1 bits (92), Expect = 9e-04 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 2/88 (2%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXX--LRHPRLIQLYDAY 429 G+G F TV C + T +E A K LRHP +++L+ Sbjct: 24 GKGAFSTVRKCCHRETKIEYAVKILDTKNMTQRDVHKVEREARICRHLRHPNVVRLHANI 83 Query: 430 DWGKYMCVVLELITGGELFERVIDEDSF 513 + +V +L+TGGELFE ++ + + Sbjct: 84 MSDGFYFLVFDLVTGGELFEDIVAREYY 111 >SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 819 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 4/61 (6%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLTKTGN----RIKIIDFGLARFYDPEKKLQVLFG 713 +I ++++H +NI+H DLKPEN+L T +K+ DFG AR + + + + G Sbjct: 595 RILLALKYLHSKNIVHCDLKPENVLLAPITSECGYPAVKLCDFGFARIIEEKSFRRSVVG 654 Query: 714 T 716 T Sbjct: 655 T 655 >SB_3250| Best HMM Match : Pkinase (HMM E-Value=1e-09) Length = 166 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTG--NRIKIIDFGLAR 674 L+ER M + I F+H + ++H DLKP NI+ +G ++I+DFG A+ Sbjct: 44 LSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNIMYADDSGTPESLRIVDFGFAK 99 Score = 33.1 bits (72), Expect = 0.23 Identities = 12/26 (46%), Positives = 21/26 (80%) Frame = +1 Query: 421 DAYDWGKYMCVVLELITGGELFERVI 498 +AY+ GK + +V+EL+ GGEL +R++ Sbjct: 14 EAYEAGKQVYIVMELMRGGELLDRIL 39 >SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) Length = 434 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTG--NRIKIIDFGLAR 674 L+ER M + I F+H + ++H DLKP NI+ +G ++I+DFG A+ Sbjct: 311 LSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNIMYADDSGTPESLRIVDFGFAK 366 Score = 33.1 bits (72), Expect = 0.23 Identities = 12/26 (46%), Positives = 21/26 (80%) Frame = +1 Query: 421 DAYDWGKYMCVVLELITGGELFERVI 498 +AY+ GK + +V+EL+ GGEL +R++ Sbjct: 281 EAYEAGKQVYIVMELMRGGELLDRIL 306 >SB_45| Best HMM Match : Pkinase (HMM E-Value=0) Length = 851 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +3 Query: 525 ACTVFMRQICEGIEFVHRQNILHLDLKPENILC-LTKTGNRIKIIDFGLARFYDPEKKLQ 701 A + + +G+ ++H ++ILH DLKP N+L R+KI DFGL++ + Sbjct: 567 ALLTLSKDLVDGLHYLHGKSILHRDLKPNNLLYHFQDETPRLKIADFGLSKDTTSASQSS 626 Query: 702 VLFGT 716 + GT Sbjct: 627 TVIGT 631 >SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) Length = 964 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/57 (38%), Positives = 32/57 (56%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEKKLQVLFGT 716 QI + VH+ ILH DLK +NIL L K +KI DFG+++ + K + G+ Sbjct: 111 QILLALRHVHKGQILHRDLKTQNIL-LNKKRKVVKIGDFGISKILSSKSKANTVIGS 166 Score = 38.3 bits (85), Expect = 0.006 Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 2/80 (2%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXX--LRHPRLIQLYDAY 429 GRG +GTVYLCR + K +HP +I+ YD++ Sbjct: 11 GRGAYGTVYLCRRLVDNFLVIIKQIPVEEMTKEERQSALNEVKVLSMFQHPNIIRYYDSF 70 Query: 430 DWGKYMCVVLELITGGELFE 489 K + +V+E GG +++ Sbjct: 71 VQEKALMIVMEYAQGGTIYD 90 >SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/60 (33%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = +3 Query: 540 MRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLA-RFYDPEKKLQVLFGT 716 +R++ +G++++H + LH D+K N+L +++TG+ +K+ DFG+A + D K GT Sbjct: 913 LREVLKGLDYLHTEKKLHRDIKAANVL-MSETGD-VKLADFGVAGQLTDTLNKRNTFVGT 970 >SB_18517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDP 686 F I + +E +H +NI HLDLKP NI + + + K+ DFG + DP Sbjct: 175 FACDITKALEAIHNKNIAHLDLKPSNI--IVNSHDVCKLADFGCCQVTDP 222 >SB_53036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 41.9 bits (94), Expect = 5e-04 Identities = 21/61 (34%), Positives = 30/61 (49%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEK 692 LT T F I G+++ H + I HLDLKP N+ L + K+ DFG + + Sbjct: 132 LTNERRTKFAVDIARGLDYAHAKGIAHLDLKPGNV--LVGANDHCKLADFGCCQAIEENH 189 Query: 693 K 695 K Sbjct: 190 K 190 >SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) Length = 380 Score = 41.9 bits (94), Expect = 5e-04 Identities = 24/55 (43%), Positives = 33/55 (60%) Frame = +3 Query: 516 TERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFY 680 +E M Q+ EG +++H I+H DLK N+L LT G +KI DFGLAR + Sbjct: 133 SEAQIKCLMIQLLEGTKYLHEHFIVHRDLKVSNLL-LTGKG-VLKIADFGLARTF 185 >SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 478 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/60 (31%), Positives = 31/60 (51%) Frame = +3 Query: 498 RRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARF 677 + +F L T +RQ+ ++++ N +H DL N CL +K+ DFGLAR+ Sbjct: 299 KSQFKLQSAEMTEMVRQVAAAMKYLESHNFIHRDLAARN--CLIGENRTVKVADFGLARY 356 >SB_6592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 41.5 bits (93), Expect = 7e-04 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 F QI E +E +HR +H DL NIL + + N +KI DFGL+R Sbjct: 966 FCLQIAEAMEALHRDKCIHRDLAARNILVVKE--NLVKISDFGLSR 1009 >SB_2079| Best HMM Match : Pkinase (HMM E-Value=4.2e-10) Length = 210 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = +3 Query: 528 CTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFY 680 C + Q+ +E +H + ++H D+KP N+ +T TG +K+ D GL RF+ Sbjct: 115 CRKYFVQLTAALEHMHSRRVMHRDIKPANVF-ITATG-VVKLGDLGLGRFF 163 >SB_12392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 41.1 bits (92), Expect = 9e-04 Identities = 23/47 (48%), Positives = 30/47 (63%), Gaps = 2/47 (4%) Frame = +3 Query: 537 FMRQICEGIEFVHRQN--ILHLDLKPENILCLTKTGNRIKIIDFGLA 671 F QI G+ ++H + I H DLKP+NIL L K RIK+ DFGL+ Sbjct: 169 FSGQIASGLMYLHGLSPPISHRDLKPDNIL-LDKRSMRIKLADFGLS 214 >SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1378 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +3 Query: 543 RQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEK-KLQVLFGT 716 R+ + +EF+H ++H D+K +NIL L G ++K+ DFG PE+ K + GT Sbjct: 323 RECLQALEFLHSNGVIHRDIKSDNIL-LGMDG-QVKLTDFGFCATITPEQNKRSTMVGT 379 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 394 RHPRLIQLYDAYDWGKYMCVVLELITGGELFERVID 501 +HP ++ D+Y G+ + VV+E + GG L + V + Sbjct: 275 KHPNIVNYVDSYLVGEELWVVMEYLAGGSLTDVVTE 310 >SB_7625| Best HMM Match : Pkinase (HMM E-Value=6.8e-10) Length = 279 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = +3 Query: 570 VHRQNILHLDLKPENILCLTKTGNRIKIIDFG 665 +H+ I+H DLKPENIL + + IK+IDFG Sbjct: 12 LHKNRIIHCDLKPENILLKQQGRSGIKVIDFG 43 >SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) Length = 603 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 504 RFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKII--DFGLAR 674 RF +E ++Q G+ +H NI+H D+KP N+L T + ++ DFGL + Sbjct: 281 RFDRSELQPLTVLQQATSGLAHLHSLNIVHRDIKPHNVLISKATSGHVNVMISDFGLCK 339 >SB_12792| Best HMM Match : Pkinase (HMM E-Value=1.1e-09) Length = 196 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/58 (32%), Positives = 32/58 (55%) Frame = +3 Query: 498 RRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLA 671 + R L+ V+ Q+ + +H + I+H DLKP N L + ++K+IDFG+A Sbjct: 27 KNRGCLSSTHLAVYWEQMLRAVNVIHERGIVHSDLKPANFLFVDV---QLKLIDFGIA 81 >SB_11943| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 591 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/54 (40%), Positives = 30/54 (55%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 LT+ F RQI G+E++ ++ +H DL NIL N +KI DFGL R Sbjct: 502 LTQNDLLSFARQIAVGMEYLSQKMFVHRDLAARNILIC--EDNLVKISDFGLTR 553 >SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1184 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/53 (37%), Positives = 32/53 (60%) Frame = +3 Query: 510 VLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 668 + E ++ ++ I+ VHR +H D+KP+NIL + K G+ IK+ DFGL Sbjct: 750 IFPEDYAKFYIAELVLAIDSVHRMGFVHRDIKPDNIL-IDKDGH-IKLTDFGL 800 >SB_43344| Best HMM Match : Pkinase (HMM E-Value=6.9e-08) Length = 424 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/40 (40%), Positives = 30/40 (75%) Frame = +3 Query: 549 ICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 668 + EG+E++HR+N++H D+K N++ LT + I++IDF + Sbjct: 135 VMEGVEYLHRKNVMHRDIKGANVM-LTNEAD-IRLIDFAI 172 >SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/60 (38%), Positives = 37/60 (61%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEKKLQVLFGT 716 F +I ++++H +I++ DLKPENIL L + G+ +K+ DFG A+ + K L GT Sbjct: 144 FGSEIVSAMDYLHGHSIVYRDLKPENIL-LDRDGH-VKLTDFGFAK--EVHDKTWTLCGT 199 >SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) Length = 187 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/38 (44%), Positives = 29/38 (76%) Frame = +3 Query: 561 IEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 +E++H I+H D+KP+N+L +T G+ IK+ DFGL++ Sbjct: 70 VEYLHSYGIVHRDIKPDNLL-ITSLGH-IKLTDFGLSK 105 >SB_21166| Best HMM Match : Pkinase (HMM E-Value=0) Length = 282 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/48 (39%), Positives = 29/48 (60%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPE 689 +I + ++H I+HLDLKP N+L + G+ KI DFG +F D + Sbjct: 127 EISNALVYIHNSGIVHLDLKPANVL-IADDGS-CKIGDFGCCQFVDDQ 172 >SB_33663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/48 (39%), Positives = 27/48 (56%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPE 689 QI EG+ F+ + LH DL NI L N +K+ DFGL+R + + Sbjct: 355 QIAEGMAFLEKYGYLHRDLAARNI--LVGENNTVKVADFGLSRLIEDD 400 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 391 LRHPRLIQLYDAYDWGKYMCVVLELITGGELFERVIDED 507 L HP+L+QLY + + ++ EL+ G L E + ++ Sbjct: 302 LIHPKLVQLYAVCSRDEPIYIITELMPKGSLLEHLRSDE 340 >SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1219 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/55 (41%), Positives = 29/55 (52%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARF 677 L E ++I +G+ HR+ I H DLK ENIL K N I DFG AR+ Sbjct: 164 LHENEARKIFKKIVKGVLHCHRKGIAHRDLKLENILLSRK--NEPIISDFGFARY 216 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/44 (36%), Positives = 34/44 (77%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 668 ++ Q+ + I++ H+ +++H D+KPEN+L ++KT + +K+ DFG+ Sbjct: 130 YIFQLIKAIKWCHQNDVIHRDIKPENLL-ISKT-DILKLCDFGI 171 >SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/65 (33%), Positives = 36/65 (55%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEK 692 + E+ +Q+ ++++H NILH DLK NI LTK +K+ DFG+++ + K Sbjct: 124 MEEKDILNMFQQMLSALKYIHNNNILHRDLKTANIF-LTK-DTVVKLGDFGISKQLEGSK 181 Query: 693 KLQVL 707 VL Sbjct: 182 ANTVL 186 >SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1427 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/62 (32%), Positives = 38/62 (61%) Frame = +3 Query: 489 KSHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 668 +++R+RF+++ C FM Q+ G+ ++ + +H DL N+ L ++ ++KI DFGL Sbjct: 257 RNNRQRFMVST-LCD-FMIQVASGMAYLESKRFIHRDLAARNV--LLESNEKVKIGDFGL 312 Query: 669 AR 674 R Sbjct: 313 MR 314 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/53 (32%), Positives = 32/53 (60%) Frame = +3 Query: 495 HRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKI 653 H +R L ER F+RQ+ ++++ ++ H+DLKP+N+L ++ +KI Sbjct: 147 HSKR-ALPERMARKFLRQLACALQYMRSYDVAHMDLKPQNLLLSSRHNPVLKI 198 >SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) Length = 558 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/63 (30%), Positives = 35/63 (55%) Frame = +3 Query: 510 VLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPE 689 + E ++ +I I +H +H D+KP+N+L + +TG+ IK+ DFG + + Sbjct: 176 IFEEDMARFYLAEIVMAIHSLHTMGFVHRDVKPDNVL-IDRTGH-IKLADFGSSARLSAD 233 Query: 690 KKL 698 KK+ Sbjct: 234 KKV 236 >SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 39.1 bits (87), Expect = 0.004 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 1/67 (1%) Frame = +3 Query: 519 ERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR-FYDPEKK 695 E+ + +I G++F+H I++ DLK +N+L L K G+ IK+ DFG+ + + KK Sbjct: 385 EKRSRFYAAEIVCGLQFLHELGIIYRDLKLDNVL-LDKDGH-IKLADFGMCKEGVNDSKK 442 Query: 696 LQVLFGT 716 GT Sbjct: 443 TTTFCGT 449 Score = 35.5 bits (78), Expect = 0.043 Identities = 24/90 (26%), Positives = 35/90 (38%), Gaps = 4/90 (4%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXXL----RHPRLIQLYD 423 G+G FG V LC K T A K L RHP L L+ Sbjct: 294 GKGSFGKVLLCELKETKEFFAIKALKKDVVLEDDDVECTMVERRVLALATRHPFLTHLHS 353 Query: 424 AYDWGKYMCVVLELITGGELFERVIDEDSF 513 A+ ++ V+E + GG+L + ++ F Sbjct: 354 AFQSADHLFFVMEYLNGGDLMFHIQNQGKF 383 >SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) Length = 490 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 1/69 (1%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL-ARFYDPE 689 L+E R + + + F+H Q ++H D+K ++IL LT G +K+ DFG A+ + Sbjct: 309 LSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSIL-LTSNGT-VKLSDFGFCAQVTEDM 366 Query: 690 KKLQVLFGT 716 + + L GT Sbjct: 367 PRRKSLVGT 375 >SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/68 (30%), Positives = 31/68 (45%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEK 692 L ER Q+ +E +H +I+H DLK EN+ N +K+ DFG + E Sbjct: 155 LPERIAKKLYGQVLSAVEHMHDNDIIHRDLKAENVFIAGP--NLVKVGDFGFSTTATKES 212 Query: 693 KLQVLFGT 716 L G+ Sbjct: 213 ALNTFCGS 220 Score = 35.1 bits (77), Expect = 0.057 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 391 LRHPRLIQLYDAYDWGKYMCVVLELITGGELFERVIDE 504 L HP +I+LY+ + + +V+E GGELF ++ +E Sbjct: 115 LHHPNIIRLYEVIETLSKLHIVMEYACGGELFAKISNE 152 >SB_24478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 747 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = +3 Query: 549 ICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 + EGI F+H Q ++H D+K +N+L +K NR KI D G + Sbjct: 574 VVEGIRFLHSQGLVHRDIKLKNVLLDSK--NRGKITDLGFCK 613 >SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2229 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/47 (40%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLT-KTGN--RIKIIDFGLARF 677 QI + + ++H +++ DLKPENIL + G+ +K+IDFG A F Sbjct: 1622 QIADALAYLHTLGVIYRDLKPENILVWSLNEGDDLYVKLIDFGTANF 1668 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTG--NRIKIIDFGLARFYDPE 689 + Q+C ++ +H I+H D+K +N+L G +R K+ DF A + + E Sbjct: 644 YWTQVCMAVDHIHTSGIIHKDIKAKNVLLCLNQGELHRAKLSDFDSAMWLEQE 696 >SB_21129| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) Length = 786 Score = 37.9 bits (84), Expect = 0.008 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = +3 Query: 540 MRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLA-RFYDPEKKLQVLFGT 716 M Q+ +G+ ++H I+H DL NI L + KI DFGLA R P++K + GT Sbjct: 1 MLQVVKGVLYLHSHGIIHRDLSLGNI--LLSSDMDAKIADFGLATRLSLPDEKHYTMCGT 58 >SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 F Q+ +G+E++ Q I+H DL NI L G K+ DFG+A+ Sbjct: 542 FAWQVADGMEYLSSQKIIHRDLAARNI--LVGEGEVCKVADFGMAK 585 >SB_43870| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 869 Score = 37.9 bits (84), Expect = 0.008 Identities = 20/46 (43%), Positives = 27/46 (58%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 F QI +G+E++ + +H DL NI L N +KI DFGLAR Sbjct: 521 FCYQIAKGMEYLASRKCIHRDLAARNI--LVADDNILKIADFGLAR 564 >SB_25445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 510 VLTERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 620 VL E F RQI + ++H + H DLKPEN+L Sbjct: 147 VLEEDEARGFFRQIISAVAYIHEKGYAHRDLKPENLL 183 >SB_20165| Best HMM Match : Pkinase (HMM E-Value=0.00013) Length = 150 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 3/46 (6%) Frame = +3 Query: 549 ICEGIEFVHRQNILHLDLKPENILCLT-KTGNRI--KIIDFGLARF 677 + EG+ ++H+ I++ DLKP NIL + G I KI D+G+AR+ Sbjct: 1 VAEGLAYLHKHMIVYRDLKPHNILIFSLSLGILINAKISDYGIARY 46 >SB_33662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 37.5 bits (83), Expect = 0.011 Identities = 20/46 (43%), Positives = 26/46 (56%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYD 683 QI G+ ++ N +H DL NIL K N +KI DFGL+R D Sbjct: 346 QIAAGMAYLEINNYIHRDLAARNILVGEK--NIVKIADFGLSRLID 389 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 391 LRHPRLIQLYDAYDWGKYMCVVLELITGGELFE 489 LRHP+L+QLY + + +V EL+ G L + Sbjct: 294 LRHPKLVQLYAVCTKEEPIYIVTELMGHGSLLD 326 >SB_11865| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.7e-07) Length = 184 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 510 VLTERACTVFMRQICEGIEFVHRQNILHLDLKPENI 617 V+ E F +C +EF+H + I HLD+KP NI Sbjct: 139 VIDESRRLKFACHLCSALEFIHEREIAHLDVKPANI 174 >SB_34306| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 37.1 bits (82), Expect = 0.014 Identities = 19/51 (37%), Positives = 32/51 (62%) Frame = +3 Query: 522 RACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 RA ++ ++Q+ G+ VH + ++H D+KP NIL G + I DFG+A+ Sbjct: 107 RALSI-VQQVASGLAVVHGKGLVHRDIKPANIL-FRSDGTAV-ITDFGVAK 154 >SB_8553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 982 Score = 37.1 bits (82), Expect = 0.014 Identities = 18/46 (39%), Positives = 26/46 (56%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 F Q+ G+E++ + +H DL N+ L + IKI DFGLAR Sbjct: 585 FSYQVARGMEYLESKKCIHRDLAARNV--LVSDNHVIKIADFGLAR 628 >SB_22843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1138 Score = 36.7 bits (81), Expect = 0.019 Identities = 22/63 (34%), Positives = 33/63 (52%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEK 692 L E F +I + + ++H I++ DLKP +L L GN +K+ DF LAR E Sbjct: 93 LPEATVKHFGAEIAKALFYIHTLGIVYCDLKPSKVL-LDGPGN-VKLSDFALARVEGEED 150 Query: 693 KLQ 701 L+ Sbjct: 151 FLE 153 >SB_22496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/46 (36%), Positives = 28/46 (60%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 + QI E++H ++++ DLKPEN+L K +K+ DFG A+ Sbjct: 8 YASQIVLAFEYLHSLDLIYRDLKPENLLIDEK--GYLKVTDFGFAK 51 >SB_19615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1376 Score = 36.7 bits (81), Expect = 0.019 Identities = 21/60 (35%), Positives = 32/60 (53%) Frame = +3 Query: 486 RKSHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFG 665 R+ H+ ER V M Q+ ++ +H + I+H DL EN+L L GN I + +FG Sbjct: 1169 REEHKENPDAYERNVCVLMIQLFAALDHLHSEGIVHRDLNAENLL-LLDAGNLI-VANFG 1226 >SB_18146| Best HMM Match : Pkinase (HMM E-Value=0) Length = 888 Score = 36.7 bits (81), Expect = 0.019 Identities = 22/63 (34%), Positives = 33/63 (52%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEK 692 L E F +I + + ++H I++ DLKP +L L GN +K+ DF LAR E Sbjct: 93 LPEATVKHFGAEIAKALFYIHTLGIVYCDLKPSKVL-LDGPGN-VKLSDFALARVEGEED 150 Query: 693 KLQ 701 L+ Sbjct: 151 FLE 153 >SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) Length = 286 Score = 36.7 bits (81), Expect = 0.019 Identities = 18/59 (30%), Positives = 35/59 (59%) Frame = +3 Query: 498 RRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 +R+ L E + +IC + F+H + +++ DLK +N+L L G+ IK+ D+G+ + Sbjct: 116 QRQRRLPEDHARFYSAEICCALNFLHEKGVIYRDLKLDNVL-LDSDGH-IKLTDYGMCK 172 >SB_13922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1012 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +3 Query: 528 CTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 668 C QI +E+ H + ++H DLKP NI +K+ DFGL Sbjct: 767 CFNVFEQIVNAVEYFHNRGMMHRDLKPSNI--FFSLDGLVKVGDFGL 811 >SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) Length = 632 Score = 36.7 bits (81), Expect = 0.019 Identities = 20/51 (39%), Positives = 30/51 (58%) Frame = +3 Query: 519 ERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLA 671 E + Q+ G+ +H Q I++ DLKPEN+L L G+ ++I D GLA Sbjct: 184 EERAVFYAAQVTLGLIHLHSQRIVYRDLKPENLL-LDDYGH-VRISDLGLA 232 >SB_36849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/47 (34%), Positives = 29/47 (61%) Frame = +3 Query: 534 VFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 ++M Q+ + ++H I H D+KP+N+L +T +K+ DFG A+ Sbjct: 166 LYMYQLFRSLTYIHCLGICHRDIKPQNLLLDPETA-VLKLCDFGSAK 211 >SB_33962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 823 Score = 36.7 bits (81), Expect = 0.019 Identities = 20/59 (33%), Positives = 32/59 (54%) Frame = +3 Query: 498 RRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 + F L ++ + QI +G++F+ + +H DL N+ L G +KI DFGLAR Sbjct: 455 KTEFTLADQVVDAY--QIAQGMDFLASKKCIHRDLAARNV--LVDEGYALKIGDFGLAR 509 >SB_42680| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 700 Score = 36.3 bits (80), Expect = 0.025 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 510 VLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRI-KIIDFGLAR 674 VLT F Q+ +G+E++ ++ +H DL N+L N++ K+ DFGL R Sbjct: 612 VLTSGDLMAFAWQVAQGMEYLSKRGFVHRDLAARNVLV---GDNKVAKVADFGLTR 664 >SB_39043| Best HMM Match : Pkinase (HMM E-Value=2.7e-09) Length = 239 Score = 36.3 bits (80), Expect = 0.025 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +3 Query: 519 ERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 620 E+ R + G++++ ++ ILH D+KPENIL Sbjct: 66 EKVARKIFRDVMRGVDYLDKRGILHNDIKPENIL 99 >SB_33824| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 36.3 bits (80), Expect = 0.025 Identities = 13/41 (31%), Positives = 26/41 (63%) Frame = +1 Query: 391 LRHPRLIQLYDAYDWGKYMCVVLELITGGELFERVIDEDSF 513 L+H R+++LY ++ GKY+ V++ + GG L E ++ + Sbjct: 22 LQHDRIVRLYASFRTGKYLYFVMDFMPGGNLLEDMLASQKY 62 >SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) Length = 1486 Score = 36.3 bits (80), Expect = 0.025 Identities = 17/42 (40%), Positives = 27/42 (64%) Frame = +3 Query: 495 HRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 620 +R+R L E F+RQI ++++H+ I+H DLK EN+L Sbjct: 273 YRKR--LGETEVRKFIRQIISAVQYLHQGGIIHRDLKVENLL 312 >SB_24175| Best HMM Match : Pkinase (HMM E-Value=6.2e-07) Length = 268 Score = 36.3 bits (80), Expect = 0.025 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +3 Query: 519 ERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 620 E+ R + G++++ ++ ILH D+KPENIL Sbjct: 158 EKVARKIFRDVMRGVDYLDKRGILHNDIKPENIL 191 >SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) Length = 1850 Score = 36.3 bits (80), Expect = 0.025 Identities = 13/42 (30%), Positives = 27/42 (64%) Frame = +3 Query: 540 MRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFG 665 + QI I+++H+ +I+H L+P+NI+ + ++K+ FG Sbjct: 1039 LAQIAMVIQYIHQSDIVHCSLRPDNIMVAQQAPLKVKLTRFG 1080 >SB_25818| Best HMM Match : Pkinase (HMM E-Value=1.7e-20) Length = 956 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +3 Query: 510 VLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLT 629 VL E +R++ +G+E+ H+ ++H D+K NIL T Sbjct: 799 VLEEDIIATVLREVLKGLEYFHKNGLIHRDVKAGNILLAT 838 >SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 35.9 bits (79), Expect = 0.033 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 2/46 (4%) Frame = +3 Query: 540 MRQICEGIEFVHRQNILHLDLKPENILCL--TKTGNRIKIIDFGLA 671 ++Q+ + + ++H DLKPENI+ + K R+K+IDFG A Sbjct: 204 VQQVLVALSKLRTLGLIHADLKPENIMLVDPDKQPFRVKVIDFGSA 249 >SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 525 Score = 35.9 bits (79), Expect = 0.033 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEK 692 QI G+ F+ + N +H DL NI L K+ DFGLAR + ++ Sbjct: 362 QIAAGMAFLEKMNYIHRDLAARNI--LVGENYACKVADFGLARLIEDDE 408 >SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 35.5 bits (78), Expect = 0.043 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Frame = +3 Query: 483 VRKSHRRRFVLTERACTVFMRQICEGIEFVHR--QNILHLDLKPENILCLTKTG-NRIKI 653 ++ S + +L E T+ M + G+ ++H Q +H DL P+NIL L K KI Sbjct: 98 IKDSKSKPKLLLEEVVTI-MLDVANGLNYLHTRIQPTIHRDLCPKNILILKKDSVITAKI 156 Query: 654 IDFGLAR 674 D GLA+ Sbjct: 157 TDVGLAK 163 >SB_37647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 666 Score = 35.5 bits (78), Expect = 0.043 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +3 Query: 519 ERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 620 E+ R + G++++ ++ ILH D+KPENIL Sbjct: 516 EKGARKIFRDVMRGVKYLDQRGILHNDIKPENIL 549 >SB_25981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 35.1 bits (77), Expect = 0.057 Identities = 13/32 (40%), Positives = 25/32 (78%) Frame = +1 Query: 409 IQLYDAYDWGKYMCVVLELITGGELFERVIDE 504 I + + ++ ++ +VLEL+TGGELF+RV+++ Sbjct: 14 IHMKELFETHTHLFMVLELVTGGELFDRVVEK 45 >SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10) Length = 460 Score = 35.1 bits (77), Expect = 0.057 Identities = 11/35 (31%), Positives = 25/35 (71%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENI 617 L+E + + Q+ +G++++H +++H+D+KP NI Sbjct: 235 LSEADLKMLLLQLAQGLKYIHSLHLVHMDIKPGNI 269 >SB_19466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 35.1 bits (77), Expect = 0.057 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLA 671 F I + +EF+H +H D+K N+L K G K+ DFG A Sbjct: 23 FTTDILKAVEFMHGNGFIHNDIKGANVLVDDK-GRTAKLTDFGSA 66 >SB_6977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 35.1 bits (77), Expect = 0.057 Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +3 Query: 591 HLDLKPENILCLTKTGN-RIKIIDFGLARFYDPEK 692 H DLKPEN+L +K N +K+ DFGLA + EK Sbjct: 21 HRDLKPENLLLASKEKNAAVKLADFGLAIEVEIEK 55 >SB_31555| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1063 Score = 34.7 bits (76), Expect = 0.076 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 Q+ G+E+V +H DL N CL T +KI DFG++R Sbjct: 952 QVAAGMEYVASLRFVHRDLATRN--CLVGTDMVVKIADFGMSR 992 >SB_18697| Best HMM Match : Pkinase (HMM E-Value=5.9e-07) Length = 216 Score = 34.7 bits (76), Expect = 0.076 Identities = 20/82 (24%), Positives = 36/82 (43%) Frame = +1 Query: 259 RGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXXLRHPRLIQLYDAYDWG 438 RGK+ + C+E T L AK L+H RL+ + DA+ Sbjct: 54 RGKYAVIKRCQETKTKKNLVAKLIKYDKDTEKIAVQEYEIMKD-LKHDRLLTVRDAFHVR 112 Query: 439 KYMCVVLELITGGELFERVIDE 504 KY+ ++++++ G E + D+ Sbjct: 113 KYVVIMMDIVEGKNCLEFLGDK 134 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 519 ERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 620 E MRQ + ++++H NI+HLD++ + I+ Sbjct: 139 EEDAAFVMRQTLDALKYLHSNNIVHLDVRGDFII 172 >SB_16900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 34.7 bits (76), Expect = 0.076 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 Q+ + ++ N +H DL N CL N +K+ DFGL+R Sbjct: 322 QVGSAMSYLESMNFIHRDLAARN--CLVGDNNLVKVADFGLSR 362 >SB_57764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 462 Score = 34.3 bits (75), Expect = 0.10 Identities = 27/106 (25%), Positives = 42/106 (39%) Frame = +1 Query: 187 PVSRCHDQKKHGCEREL*DALGNGRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXX 366 P + CH +K+ R + GRG FGTVY + G +A K Sbjct: 254 PNTSCHREKRSNILRNV-----IGRGAFGTVY--KATWAGTPVAVKVIRVRNASVSSELE 306 Query: 367 XXXXXXXXLRHPRLIQLYDAYDWGKYMCVVLELITGGELFERVIDE 504 +RHP +IQ+ + ++ ELI G L + + +E Sbjct: 307 NEVAVHSLVRHPNIIQIMGVSFIKNLVYIISELIDGKNLDDILFEE 352 >SB_42485| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1565 Score = 34.3 bits (75), Expect = 0.10 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 QI +G+EF+ R+ +H DL N+ L +K+ DFGLAR Sbjct: 1245 QISKGMEFLARKKCVHRDLAARNV--LVGPDYVMKVSDFGLAR 1285 >SB_22527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 34.3 bits (75), Expect = 0.10 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRI-KIIDFGLAR 674 F Q+ +G+E++ R+ +H DL N+L N++ K+ DFGL R Sbjct: 736 FAWQVAQGMEYLARRGFVHRDLAARNVLV---GDNKVAKVADFGLTR 779 >SB_9759| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 387 Score = 34.3 bits (75), Expect = 0.10 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 LT+ Q+ G+E + +H DL N CL G +KI DFG++R Sbjct: 63 LTQEDLLSISLQVSSGMEHLQSMRFVHRDLATRN--CLVGDGLVVKIADFGMSR 114 Score = 34.3 bits (75), Expect = 0.10 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 LT+ Q+ G+E + +H DL N CL G +KI DFG++R Sbjct: 246 LTQEDLLSISLQVSSGMEHLQSMRFVHRDLATRN--CLVGDGLVVKIADFGMSR 297 >SB_14773| Best HMM Match : Pkinase (HMM E-Value=1.1e-05) Length = 194 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/35 (51%), Positives = 25/35 (71%) Frame = +3 Query: 597 DLKPENILCLTKTGNRIKIIDFGLARFYDPEKKLQ 701 DLKP N+L ++ TG+ +KI DFGLAR + E + Q Sbjct: 1 DLKPANLL-ISSTGH-LKIADFGLARVFSNEGERQ 33 >SB_26437| Best HMM Match : Pkinase (HMM E-Value=3.6e-36) Length = 436 Score = 33.9 bits (74), Expect = 0.13 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 5/59 (8%) Frame = +3 Query: 531 TVFMRQICEGIEFVH--RQNILHLDLKPENILCLTKTG---NRIKIIDFGLARFYDPEK 692 TV R+ +++++ + ++H DLKP NIL L TG KI DFGL++ ++ ++ Sbjct: 251 TVPERETVRALKYLNEIKPPVIHYDLKPGNIL-LVGTGAFSGETKITDFGLSKIFESDE 308 >SB_39694| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 893 Score = 33.5 bits (73), Expect = 0.18 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 8/51 (15%) Frame = +3 Query: 546 QICEGIEFVHRQ---NILHLDLKPENILCLTKTG-----NRIKIIDFGLAR 674 QI +G+ ++H + I+H DLK NIL K N +KI DFGLAR Sbjct: 188 QIAQGMFYLHSEAPVTIVHRDLKSGNILLHYKINESDFNNILKITDFGLAR 238 >SB_26513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1460 Score = 33.5 bits (73), Expect = 0.18 Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = +3 Query: 489 KSHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCL-TKTGNRIKIIDFG 665 KS+ +R ++E + ++ +H +++H DLKP+N+L L ++ +++IDFG Sbjct: 1264 KSNGQR--ISEEVAMALTVALLRMLQTMHACDVIHGDLKPDNVLVLESENSVALRLIDFG 1321 >SB_14271| Best HMM Match : Pkinase (HMM E-Value=2.1e-27) Length = 2056 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/48 (29%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Frame = +3 Query: 540 MRQICEGIEFVHRQNILHLDLKPENILC--LTKTGNRIKIIDFGLARF 677 +++ +G+ ++H + I+H D+K NIL + ++K+ DFG A + Sbjct: 312 IKEAAKGLSYLHNKGIVHSDIKTCNILVGESSSEAYKVKLGDFGAAHY 359 >SB_4877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 517 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/48 (29%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Frame = +3 Query: 540 MRQICEGIEFVHRQNILHLDLKPENILC--LTKTGNRIKIIDFGLARF 677 +++ +G+ ++H + I+H D+K NIL + ++K+ DFG A + Sbjct: 293 IKEAAKGLSYLHNKGIVHSDIKTCNILVGESSSEAYKVKLGDFGAAHY 340 >SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) Length = 560 Score = 33.5 bits (73), Expect = 0.18 Identities = 17/48 (35%), Positives = 29/48 (60%) Frame = +3 Query: 540 MRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYD 683 M+ I E + ++H + ++HLDLK N+L +K +K+ DFG + D Sbjct: 444 MQVILEALCWLHSKGVVHLDLKGGNVLMDSK--GIVKLADFGASVHLD 489 >SB_47579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 33.1 bits (72), Expect = 0.23 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 4/68 (5%) Frame = +3 Query: 483 VRKSHRRRFVLTERACTVFMRQICEGIEFVHRQ----NILHLDLKPENILCLTKTGNRIK 650 ++K R + E + Q+ ++ HR+ ++LH DLKP N+ +K Sbjct: 99 IKKHKREKRYTAEDLVWKLLYQLVLAVQECHRRKDGGHVLHRDLKPANV--FLDANMNVK 156 Query: 651 IIDFGLAR 674 + DFGLAR Sbjct: 157 LGDFGLAR 164 >SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) Length = 310 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/41 (34%), Positives = 26/41 (63%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 668 QI +G+ ++H + I+H DL+ +N+ + ++ I DFGL Sbjct: 119 QIAQGMGYLHARGIVHTDLRSKNV--FLELNSKAVITDFGL 157 >SB_41626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 33.1 bits (72), Expect = 0.23 Identities = 20/65 (30%), Positives = 31/65 (47%) Frame = +3 Query: 480 AVRKSHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIID 659 A + H +F E + Q+ G+EF+ + +H DL N+ L +K+ D Sbjct: 525 APSEDHDVQFTQMELVSAAY--QVARGMEFLASRRCIHRDLAARNV--LIADDYVLKVAD 580 Query: 660 FGLAR 674 FGLAR Sbjct: 581 FGLAR 585 >SB_11148| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 196 Score = 33.1 bits (72), Expect = 0.23 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +3 Query: 507 FVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR-FYD 683 F LT+ T F Q+ ++F+ + +H DL N+ L +KI DFGLAR Y Sbjct: 62 FTLTDLVITSF--QVSRAMQFLASRRCVHRDLAARNV--LVGENYVMKIADFGLARDIYK 117 Query: 684 PEKKLQVLFG 713 E ++ G Sbjct: 118 EEHYVKTTAG 127 >SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1052 Score = 32.7 bits (71), Expect = 0.31 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 F QI G+E++ + +H DL NI L +KI DFGLAR Sbjct: 854 FAFQIARGMEYLSFKKCIHRDLAARNI--LVGEDYVMKIADFGLAR 897 >SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) Length = 256 Score = 32.7 bits (71), Expect = 0.31 Identities = 21/89 (23%), Positives = 39/89 (43%), Gaps = 3/89 (3%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAKXXXXXXXXXXXXXXXXXXXXXXLRHPR---LIQLYDA 426 GRG FG V L +++ TG A K L ++++Y + Sbjct: 57 GRGAFGEVRLVQKQDTGHVYAMKILRKADMLEKEQVAHARAERDILAEAENQWVVKMYYS 116 Query: 427 YDWGKYMCVVLELITGGELFERVIDEDSF 513 + Y+ +V+E + GG+L ++ +D+F Sbjct: 117 FQDDYYLFLVMEFLPGGDLMTLLMKKDTF 145 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/54 (20%), Positives = 28/54 (51%) Frame = +3 Query: 501 RRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDF 662 ++ TE ++ + I+ +H+ +H D+KP+N+L ++ + + D+ Sbjct: 141 KKDTFTEEETRFYIAEALLAIDSIHQLGFIHRDIKPDNLLLDSRAYSTVGTPDY 194 >SB_9807| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.00031) Length = 310 Score = 32.7 bits (71), Expect = 0.31 Identities = 21/83 (25%), Positives = 32/83 (38%), Gaps = 5/83 (6%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAK-----XXXXXXXXXXXXXXXXXXXXXXLRHPRLIQLY 420 G G FG VY+C + TG ELA K R+ R++Q Y Sbjct: 197 GAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAFRNERIVQYY 256 Query: 421 DAYDWGKYMCVVLELITGGELFE 489 ++ + +E + GG + E Sbjct: 257 GIETDDLHIYIFMEYLPGGSIHE 279 >SB_55249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 32.3 bits (70), Expect = 0.40 Identities = 11/28 (39%), Positives = 20/28 (71%), Gaps = 2/28 (7%) Frame = +3 Query: 543 RQICEGIEFVH--RQNILHLDLKPENIL 620 RQ+C+ + ++H + +LH D+KP N+L Sbjct: 405 RQLCQAVAYLHNLKPQVLHKDIKPANVL 432 >SB_42486| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1554 Score = 32.3 bits (70), Expect = 0.40 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +3 Query: 531 TVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 T+ Q+ G+EF+ + +H DL N+ L +K+ DFGLAR Sbjct: 949 TMASYQVSRGVEFLASRKCVHRDLAARNV--LVGPDYVMKVSDFGLAR 994 >SB_37572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 32.3 bits (70), Expect = 0.40 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +3 Query: 549 ICEGIEFVHRQ-NILHLDLKPENILCLTKTGNRIKIIDFGLA 671 + +E++H ++H D+KP NIL + + GN K+ DFG++ Sbjct: 137 VVSALEYLHSNLKVIHRDVKPSNIL-VDERGN-FKLCDFGIS 176 >SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKI---IDFGLAR 674 QI + ++ +H LH D+KP N + T + + I +DFGL+R Sbjct: 31 QILKSVKSIHEAGFLHRDIKPSN-FAMGNTPDTVHICYMLDFGLSR 75 >SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1038 Score = 32.3 bits (70), Expect = 0.40 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +3 Query: 558 GIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR-FYD 683 G+E++ +N +H DL N CL + +KI DFG++R YD Sbjct: 693 GMEYLASKNCIHRDLAARN--CLIGEDDVLKISDFGMSREVYD 733 >SB_21044| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1507 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 +T +A Q+ G++++ +H DL N CL +KI DFG++R Sbjct: 342 VTYQALLYMALQLAAGMKYIASHQFVHRDLATRN--CLVGHSFTVKIADFGMSR 393 >SB_52903| Best HMM Match : DUF1126 (HMM E-Value=0) Length = 1452 Score = 31.9 bits (69), Expect = 0.53 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENIL 620 Q+ ++F+H + H DLKPEN+L Sbjct: 818 QLIVAVKFLHEMKLTHTDLKPENML 842 >SB_37607| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-23) Length = 267 Score = 31.9 bits (69), Expect = 0.53 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 +TE+ F +I +G+ + ++ +H DL NI L N + DFGL+R Sbjct: 179 MTEKEKFKFAYEIAKGMRHLEKKKCVHRDLAARNI--LLNVDNVAMVSDFGLSR 230 >SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) Length = 865 Score = 31.9 bits (69), Expect = 0.53 Identities = 15/48 (31%), Positives = 27/48 (56%) Frame = +3 Query: 477 RAVRKSHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 620 R V + + + L +A + +Q+ ++ + R ILH D+KP+NIL Sbjct: 751 REVLRKYGQNVGLHIKAVRSYSQQLFLALKLMKRTGILHADIKPDNIL 798 >SB_3163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 31.9 bits (69), Expect = 0.53 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAK 324 G G+F V C EKS+GLE AAK Sbjct: 24 GSGQFAVVKKCSEKSSGLEFAAK 46 >SB_26337| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-21) Length = 602 Score = 31.9 bits (69), Expect = 0.53 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 +TE+ F +I +G+ + ++ +H DL NI L N + DFGL+R Sbjct: 514 MTEKEKFKFAYEIAKGMRHLEKKKCVHRDLAARNI--LLNVDNVAMVSDFGLSR 565 >SB_9978| Best HMM Match : Pkinase (HMM E-Value=3.4e-17) Length = 348 Score = 31.9 bits (69), Expect = 0.53 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +1 Query: 394 RHPRLIQLYDAYDWGKYMCVVLELITGGELFERVIDEDSF*QSAPV 531 RHP L+ L+ + +++C V+E GG+L I D F +S V Sbjct: 231 RHPFLVNLFACFQTQEHVCFVMEYAPGGDLMMH-IHADVFAESRTV 275 >SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10) Length = 251 Score = 31.5 bits (68), Expect = 0.71 Identities = 14/53 (26%), Positives = 30/53 (56%) Frame = +3 Query: 507 FVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFG 665 + + E+ + ++ ++ +H +H D+KP+N+L L G+ +K+ DFG Sbjct: 130 YEIPEKWAKFYCAEVVLALDAIHTMGFVHRDVKPDNML-LDGEGH-LKLADFG 180 >SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 31.5 bits (68), Expect = 0.71 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGL 668 ++ER F+ + G++ +H ++H+D+KP N+ KI DFGL Sbjct: 572 VSEREVWNFLLDLTLGLKHLHDSGMVHMDIKPANV--FFGHDGLCKIGDFGL 621 >SB_26242| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.8e-15) Length = 1019 Score = 31.1 bits (67), Expect = 0.93 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +3 Query: 543 RQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 RQ+ G+ ++ I+H +L EN CL R+KI F AR Sbjct: 369 RQVLTGMAYLEESGIVHGELVAEN--CLVGDNGRVKISGFHCAR 410 >SB_19037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 31.1 bits (67), Expect = 0.93 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = +3 Query: 585 ILHLDLKPENILCLTKTG--NRIKIIDFGLAR 674 ++H DLKP NI+ +G ++I+DFG A+ Sbjct: 1 VVHRDLKPSNIMYADDSGTPESLRIVDFGFAK 32 >SB_1550| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 931 Score = 31.1 bits (67), Expect = 0.93 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +3 Query: 543 RQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYD 683 R + G+ ++ N +H DL NI L K+ DFGL+R D Sbjct: 678 RGVAAGMAYLSEMNFIHRDLAARNI--LVSDNLAAKVSDFGLSRELD 722 >SB_28925| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 792 Score = 31.1 bits (67), Expect = 0.93 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +3 Query: 543 RQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYD 683 R + G++++ N +H DL NI L K+ DFGL+R D Sbjct: 551 RGVAAGMDYLSSINFIHRDLAARNI--LVSENMTTKVSDFGLSRELD 595 >SB_27024| Best HMM Match : Pkinase (HMM E-Value=4.7e-25) Length = 1595 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/51 (25%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Frame = +3 Query: 546 QICEGIEFVHRQNILHLDLKPENILCLTKTGN---RIKIIDFGLARFYDPE 689 Q+ + ++H +I++ DLK +N+L + +K+ D+G++ F P+ Sbjct: 505 QVASALWYLHDSDIIYRDLKTDNVLVWSLHDTDLVNVKLSDYGISCFATPQ 555 >SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) Length = 315 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/28 (42%), Positives = 23/28 (82%), Gaps = 2/28 (7%) Frame = +3 Query: 555 EGIEFVHRQ-NILHLDLKPENI-LCLTK 632 +G++++H + I+H D+KPENI LC+++ Sbjct: 157 KGLDYLHTKCKIIHTDIKPENILLCISQ 184 >SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +3 Query: 480 AVRKSHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLK 605 ++ + ++ L E + RQI EGI ++H I+H D+K Sbjct: 2 SIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIK 43 >SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) Length = 501 Score = 30.7 bits (66), Expect = 1.2 Identities = 28/103 (27%), Positives = 38/103 (36%), Gaps = 2/103 (1%) Frame = +1 Query: 181 PVPVSRCHDQKKHGCEREL*DALGNGRGKFGTVYLCREKSTGLELAAK--XXXXXXXXXX 354 P+ +R D+K+ E LG RG FG V + TG A K Sbjct: 11 PIKHTRIEDEKQIEDVYEFGQVLG--RGSFGVVNEAKHIETGTRWAIKAVNKEKAGSSAV 68 Query: 355 XXXXXXXXXXXXLRHPRLIQLYDAYDWGKYMCVVLELITGGEL 483 + H LI L + Y+ K M +V+EL G L Sbjct: 69 KLLEREVMIMKKIYHEHLIHLEEIYETSKRMYLVMELCDAGGL 111 >SB_23400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +3 Query: 549 ICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 +CEG+ + I+H DL NIL L N K+ DFG +R Sbjct: 164 VCEGLVHIAECGIIHGDLAARNIL-LDSHANP-KLADFGFSR 203 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 397 HPRLIQLYDAYDWGKYMCVVLELITGGELFERV 495 HP +++L A K + VV E ++GG L + V Sbjct: 106 HPNIVKLIGACSVEKPLLVVTEYLSGGNLLDHV 138 >SB_51639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +3 Query: 30 CLDCSVPVDVQLSGNINIISDARECNVNSFIEDHQK 137 C DCS P++ +L G N I D R + + K Sbjct: 52 CADCSAPIETELQGVRNYIDDIRGDQERKYAQKRDK 87 >SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 2629 Score = 29.9 bits (64), Expect = 2.2 Identities = 18/54 (33%), Positives = 24/54 (44%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 L + F I +G+ F+ +H DL N+ L N KI D GLAR Sbjct: 257 LVSKDLVKFAWMIADGMAFLAANKCVHRDLAARNV--LVGEHNTCKISDLGLAR 308 >SB_26833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 854 Score = 29.9 bits (64), Expect = 2.2 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = +1 Query: 391 LRHPRLIQLYDAYDWGKYMCVVLELITGGELFE 489 LRHP +++ + A++ + + +++EL+ G L E Sbjct: 257 LRHPNIVRYFKAFEEKEKLYIIMELVEGAPLGE 289 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = +3 Query: 519 ERACTVFMRQICEGIEFVHRQ-NILHLDLKPENIL 620 ER +F+ QI G+ ++H++ +I+H DL P NI+ Sbjct: 304 ERIWHIFI-QIVLGLRYIHKEKHIVHRDLTPNNIM 337 >SB_22903| Best HMM Match : 7tm_1 (HMM E-Value=3.2e-05) Length = 885 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -3 Query: 274 FRICLVRFREHLIVLVHIRVSFDRDISTRERGLDLSHGICFIY 146 F+I V R H ++ +H R+ F+++ R R S + +IY Sbjct: 137 FKIYQVVRRHHRLICIHDRIQFNQETIVRMRRRKASFDVLYIY 179 >SB_18047| Best HMM Match : Pkinase (HMM E-Value=2.1e-07) Length = 179 Score = 29.9 bits (64), Expect = 2.2 Identities = 18/42 (42%), Positives = 23/42 (54%) Frame = +3 Query: 573 HRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEKKL 698 H+ I H D+K +NI L K+ I DFGLA +D KL Sbjct: 44 HKPCIAHRDVKSKNI--LVKSDLTCCISDFGLALKFDQSDKL 83 >SB_45888| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.4e-25) Length = 561 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/54 (31%), Positives = 24/54 (44%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 L ER + G+ + + +H DL N+ L G K+ DFGLAR Sbjct: 498 LNERQLLFLALGVARGMAHLEEKQCIHRDLAARNV--LVGLGLVAKVADFGLAR 549 >SB_25669| Best HMM Match : LRR_1 (HMM E-Value=9.1e-33) Length = 1065 Score = 29.9 bits (64), Expect = 2.2 Identities = 21/67 (31%), Positives = 29/67 (43%) Frame = +3 Query: 474 RRAVRKSHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKI 653 RR K LT R + G+ + + +H DL N+L +T T K+ Sbjct: 893 RRTDSKYVNVNSTLTSRDLLRIALDVSRGMRHIAMKKFVHRDLAARNVL-MTDT-LTAKV 950 Query: 654 IDFGLAR 674 DFGLAR Sbjct: 951 ADFGLAR 957 >SB_23777| Best HMM Match : Pkinase (HMM E-Value=0.065) Length = 97 Score = 29.9 bits (64), Expect = 2.2 Identities = 18/71 (25%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAK--XXXXXXXXXXXXXXXXXXXXXXLRHPRLIQLYDAY 429 G G +G V+ CR K TG +A K L+HP L+ L + + Sbjct: 11 GEGSYGVVFKCRHKETGQIVAIKKFVESEDDPLIKKIAMREVKMLKQLKHPNLVNLLEVF 70 Query: 430 DWGKYMCVVLE 462 + + +V E Sbjct: 71 KRKRKLHLVFE 81 >SB_18432| Best HMM Match : VirB3 (HMM E-Value=6.3) Length = 179 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -3 Query: 274 FRICLVRFREHLIVLVHIRVSFDRDISTRERGLDLSHGICFIY 146 F+I V R H ++ +H R+ F+++ R R S + +IY Sbjct: 55 FKIYQVVRRHHRLICIHDRIQFNQETIVRMRRRKASFDVLYIY 97 >SB_17071| Best HMM Match : Pkinase (HMM E-Value=0.065) Length = 97 Score = 29.9 bits (64), Expect = 2.2 Identities = 18/71 (25%), Positives = 28/71 (39%), Gaps = 2/71 (2%) Frame = +1 Query: 256 GRGKFGTVYLCREKSTGLELAAK--XXXXXXXXXXXXXXXXXXXXXXLRHPRLIQLYDAY 429 G G +G V+ CR K TG +A K L+HP L+ L + + Sbjct: 11 GEGSYGVVFKCRHKETGQIVAIKKFVESEDDPLIKKIAMREVKMLKQLKHPNLVNLLEVF 70 Query: 430 DWGKYMCVVLE 462 + + +V E Sbjct: 71 KRKRKLHLVFE 81 >SB_11275| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.0005) Length = 256 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +3 Query: 549 ICEGIEFVHRQNILHLDLKPENILCLTKTGN-RIKIIDF 662 + + + F+H + +H DLK N++ + GN IIDF Sbjct: 187 VADALHFIHGRGFVHNDLKGNNVVLEGEAGNFNPMIIDF 225 >SB_10367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 481 Score = 29.9 bits (64), Expect = 2.2 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +3 Query: 540 MRQICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLARFYDPEKK 695 ++ I E + F H++ LH DLK N++ + +ID+G A E K Sbjct: 343 LKTIAETLLFCHQKGFLHNDLKQNNVVFHYSGSWKPVVIDWGKASRVGDEVK 394 >SB_51537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 23 RHVS*LFCASGCSAQWKYQYNIGCARV*CEFVHRR 127 RHV G S W+YQ NI R C+ V RR Sbjct: 116 RHVRGQTQGEGGSQYWRYQENIPVRRTRCKLVFRR 150 >SB_46446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 29.5 bits (63), Expect = 2.8 Identities = 8/36 (22%), Positives = 23/36 (63%) Frame = +3 Query: 513 LTERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 620 + E ++++ +G++++HR +I+H +K ++L Sbjct: 68 MPEALIAAILKEVLQGLDYLHRMSIIHRGMKGGHVL 103 >SB_35734| Best HMM Match : Extensin_2 (HMM E-Value=0.52) Length = 460 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/51 (33%), Positives = 21/51 (41%) Frame = +2 Query: 458 LN**REASCSKESSTKIRSDRARLYCVHATDLRGHRVRSPPEYTPPGSKAR 610 LN R S ++ + R R +H TD GH V P PP S R Sbjct: 147 LNLSRVKSMKPDTQSMARDGRMDGRTIHQTDFPGHSVPRRPAIRPPNSDLR 197 >SB_33716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 922 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/34 (38%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +1 Query: 391 LRHPRLIQLYDAYDWGKYMCVVLELI-TGGELFE 489 L+HP ++++ DA++ ++ VV+E TG +LFE Sbjct: 645 LKHPNIVKMLDAFENEEFFQVVMEKHGTGMDLFE 678 >SB_58584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +3 Query: 570 VHRQNILHLDLKPENILCLTKTGNRIKIIDFGLA 671 +H+ + +H DL N+L + N I IIDFGL+ Sbjct: 124 MHQVDCIHGDLTTSNLLT-KNSSNAITIIDFGLS 156 >SB_40578| Best HMM Match : Pkinase (HMM E-Value=2.2e-11) Length = 385 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +3 Query: 519 ERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKT-GNRIKIIDFG 665 + +C + + Q+ G+ + + H DLK +N+L T R+ I DFG Sbjct: 97 QTSCLLLL-QLLNGLVHLQEHQVAHRDLKSDNLLLDTSVYPPRLVICDFG 145 >SB_31810| Best HMM Match : Pkinase (HMM E-Value=0.17) Length = 152 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 597 DLKPENILCLTKTGNRIKIIDFGLARFYDPEKK 695 DLKPENI L IKI DFG A+ + +++ Sbjct: 2 DLKPENI--LLDENMHIKITDFGTAKILNKDEE 32 >SB_56812| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-06) Length = 208 Score = 28.3 bits (60), Expect = 6.6 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = +3 Query: 519 ERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 620 E+ TV + + G++ +H+ ++ DLKP+N++ Sbjct: 49 EQRLTV-AKDVARGLQKIHKAEYVYRDLKPQNVM 81 >SB_55598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 668 Score = 28.3 bits (60), Expect = 6.6 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +3 Query: 555 EGIEFVHRQNILHLDLKPENIL 620 + ++F H + I+H D+KP N++ Sbjct: 472 KALDFCHSRGIMHRDVKPHNVM 493 >SB_26356| Best HMM Match : Pkinase (HMM E-Value=0.00044) Length = 634 Score = 28.3 bits (60), Expect = 6.6 Identities = 10/34 (29%), Positives = 22/34 (64%) Frame = +3 Query: 519 ERACTVFMRQICEGIEFVHRQNILHLDLKPENIL 620 E+ TV + + G++ +H+ ++ DLKP+N++ Sbjct: 547 EQRLTV-AKDVARGLQKIHKAEYVYRDLKPQNVM 579 >SB_6695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 28.3 bits (60), Expect = 6.6 Identities = 16/68 (23%), Positives = 35/68 (51%), Gaps = 2/68 (2%) Frame = +3 Query: 489 KSHRRRFVLTERACTVFMRQICEGIEFVHRQNILHLDLKPENILCLTKTG--NRIKIIDF 662 K+H+ F++ C Q+ + +E++H H D+K N++ G +++ ++D+ Sbjct: 43 KAHKFIFIMQ---CIYHFLQL-DVLEYIHANEYAHADIKGSNLMTGFGKGKSDQVYLLDY 98 Query: 663 GLARFYDP 686 GL + P Sbjct: 99 GLTFRFCP 106 >SB_51259| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.4e-08) Length = 181 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/42 (26%), Positives = 25/42 (59%) Frame = +3 Query: 549 ICEGIEFVHRQNILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 + ++++H +++H D+K +N+L K+ + DFGL + Sbjct: 25 VARALKYLHSLDLIHRDVKLQNVLVDEKSQG--SLTDFGLCK 64 >SB_40460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 28.3 bits (60), Expect = 6.6 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +3 Query: 537 FMRQICEGIEFVHRQNILHLDLKPENIL 620 F QI +G+E++ ++++H DL N+L Sbjct: 151 FSLQIADGMEYLANRHLVHRDLAARNVL 178 >SB_51468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1626 Score = 27.9 bits (59), Expect = 8.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 444 IFPPVVSVVQLDQSRVPESSHHVHLP 367 + PPV V Q + R P++ HH LP Sbjct: 1459 VVPPVEQVFQTSKRRPPQAQHHHVLP 1484 >SB_53776| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.5e-12) Length = 640 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 391 LRHPRLIQLYDAYDWGKYMCVVLELITGGELFERVID 501 L HP +I+ + CVV+E G+LFE + D Sbjct: 154 LNHPNIIRFKGVCNQAPVYCVVMEYCPYGQLFEVLRD 190 >SB_28361| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 551 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 585 ILHLDLKPENILCLTKTGNRIKIIDFGLAR 674 ++H DL N+L G KI DFGLAR Sbjct: 441 VIHRDLAARNVL--VGEGQMCKITDFGLAR 468 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,489,330 Number of Sequences: 59808 Number of extensions: 469968 Number of successful extensions: 1552 Number of sequences better than 10.0: 191 Number of HSP's better than 10.0 without gapping: 1330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1506 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -