BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20741 (694 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0236 + 15215386-15216197,15216854-15218888,15219131-152200... 29 4.6 >11_04_0236 + 15215386-15216197,15216854-15218888,15219131-15220017, 15222420-15226194 Length = 2502 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/51 (25%), Positives = 29/51 (56%) Frame = -2 Query: 573 KCLLNFSHLQFIYEIKINLIDTYGPDTHTNIDLXXI*LRYYMQYLRFVCEI 421 +C+ + + + I + + L+ G +T +DL I + + ++YL+ VC+I Sbjct: 1537 RCMPSITDFKLIRVLNLQLVGHLGENT---LDLTGISVLFQLKYLKIVCDI 1584 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,062,988 Number of Sequences: 37544 Number of extensions: 224138 Number of successful extensions: 424 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -