BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20741 (694 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42842-2|AAA83592.3| 341|Caenorhabditis elegans Hypothetical pr... 29 2.4 Z50794-2|CAA90657.2| 681|Caenorhabditis elegans Hypothetical pr... 28 7.3 >U42842-2|AAA83592.3| 341|Caenorhabditis elegans Hypothetical protein EGAP2.1 protein. Length = 341 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -2 Query: 105 ASRDDNERPQDTNDVIGSLAGKKFNN 28 A DD+ERP TN++I L +KF+N Sbjct: 51 AEEDDDERPPTTNEIIDDLV-EKFDN 75 >Z50794-2|CAA90657.2| 681|Caenorhabditis elegans Hypothetical protein F59F5.3 protein. Length = 681 Score = 27.9 bits (59), Expect = 7.3 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = -2 Query: 657 IKLIKHMFNQVLLNCLSRKKLVKILIYAKCLLNFSHLQFIYEIKINLIDTYGPDTHTNID 478 IKL K + ++ LN L + L++++ C N + + +I L T DTHT++D Sbjct: 57 IKLNKTLSGELYLN-LKVRSLLRLMFNKACDRNIACEIYKNDISSRLT-TESDDTHTSVD 114 Query: 477 L 475 L Sbjct: 115 L 115 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,397,155 Number of Sequences: 27780 Number of extensions: 240134 Number of successful extensions: 517 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -