BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20740 (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 26 1.4 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 26 1.4 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 24 5.5 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 7.3 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 25.8 bits (54), Expect = 1.4 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +1 Query: 253 HKESCICATCVVRLRDAYAFRQQVLQCEEAFLNAKLQSKEEASSRIDVQVKTEPLA 420 HK C TC A RQ+V+ + A A+ Q ++ A + + +V EP+A Sbjct: 56 HKRYCKYRTCHCEKCCLTAERQRVMALQTALRRAQTQDEQRALN--EGEVPPEPVA 109 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 25.8 bits (54), Expect = 1.4 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +1 Query: 253 HKESCICATCVVRLRDAYAFRQQVLQCEEAFLNAKLQSKEEASSRIDVQVKTEPLA 420 HK C TC A RQ+V+ + A A+ Q ++ A + + +V EP+A Sbjct: 56 HKRYCKYRTCHCEKCCLTAERQRVMALQTALRRAQTQDEQRALN--EGEVPPEPVA 109 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = -1 Query: 260 SLCLRPDWKEANQNSPLTSLNKLLFDPSIRIQMLKVGTSL*SDN 129 +L RPD K + S L DP+ +++M++ G+ + +N Sbjct: 146 ALLHRPDTKSVSVPSLLHLFPDQFIDPAAQVRMMEEGSIVLDEN 189 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.4 bits (48), Expect = 7.3 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 557 FQLLRAFVVARDFDVLMSGGFRSSE 483 +QL RAF V RD+D ++S++ Sbjct: 309 YQLARAFHVQRDYDQAFQYYYQSTQ 333 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 690,974 Number of Sequences: 2352 Number of extensions: 13314 Number of successful extensions: 67 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -