BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20740 (728 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 23 2.9 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.9 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 21 9.0 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 23.0 bits (47), Expect = 2.9 Identities = 13/51 (25%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +3 Query: 489 GPEAARHKDVKVASDYEGTKKLKRPRKAKVAGKRDLVNRMKKY-REKLDHL 638 GPE +RH + + + + K R+ K A ++ ++R +++ R +L+ L Sbjct: 78 GPETSRHTTLGLLTKAKRFIKSLEERERKHAVHKEQLSREQRFLRRRLEQL 128 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/42 (23%), Positives = 19/42 (45%) Frame = -3 Query: 177 HSYSDVKSRHFFIERQHRHNAGSTMGPLPFPAIVVTAIIYLI 52 H+YS+ H + + + +T+G P V+ + Y I Sbjct: 184 HTYSETGPSHCVVCQNFFYQIYATLGSFYIPLFVMIQVYYKI 225 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/42 (23%), Positives = 18/42 (42%) Frame = -2 Query: 706 IIVSWSIIGFDFSFLCSIFTGSIKWSSFSLYFFMRLTRSLLP 581 +I++ + G F+C T + LY F R ++P Sbjct: 13 VIINVLLHGQVICFVCKDITSTSALYRLKLYLFCDYDRDIIP 54 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,205 Number of Sequences: 438 Number of extensions: 3745 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -