BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20737 (432 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced prot... 22 3.4 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 4.5 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 5.9 >AB264335-1|BAF44090.1| 87|Apis mellifera ecdysone-induced protein 75 protein. Length = 87 Score = 21.8 bits (44), Expect = 3.4 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +3 Query: 186 CDQLASYLGKTCSGCSCCRSHREPADVFVISSRPFGQRAV 305 CD G CS S S + + FV S+ F +R++ Sbjct: 7 CDLATPRTGTNCSSGSSSDSDGQTDEGFVGDSQGFFRRSI 46 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.4 bits (43), Expect = 4.5 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +1 Query: 37 SATMSGGLDVLALNEEDVTKML 102 S TMS L LALN +DV K L Sbjct: 310 STTMSNALYELALN-QDVQKKL 330 Score = 20.6 bits (41), Expect = 7.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 Query: 150 LHLEVNIFCPK 118 L E+N FCPK Sbjct: 330 LREEINTFCPK 340 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.0 bits (42), Expect = 5.9 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = -3 Query: 274 MTNTSAGSRWLRQHEQPE 221 + NT+ S+++R++ PE Sbjct: 201 IVNTNYSSKYMREYNDPE 218 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,666 Number of Sequences: 438 Number of extensions: 2803 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11244597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -