BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20736 (592 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 3.0 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 5.2 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 5.2 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 6.8 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 6.8 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 9.0 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 9.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.0 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.6 bits (46), Expect = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 Query: 332 YHHHGHAEFGRQHVQY 285 +HHH H QH+ Y Sbjct: 351 HHHHHHQTQSLQHLHY 366 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 5.2 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 344 GQGAFGNMCRGGRMFAP 394 G G FG++CRG P Sbjct: 640 GGGEFGDVCRGKLKLPP 656 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 5.2 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = +3 Query: 411 VGTVASTSDSGERPWRHRCCYRRPSARSG*RTHIEKIPELPLVVA 545 + + S+S S P + +PS R+G T+ +++ L V+ Sbjct: 517 IASAPSSSTSSSPPAKGAAAAGQPSKRNGGETNKQELKRLKSTVS 561 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.4 bits (43), Expect = 6.8 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -3 Query: 314 AEFGRQHVQYPMIQHWFGDQLLAHAVGLPRVL 219 +E+G +VQY +Q F + +A + VL Sbjct: 287 SEYGANNVQYQGVQDIFNTESIAKIMSKNGVL 318 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.4 bits (43), Expect = 6.8 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -3 Query: 314 AEFGRQHVQYPMIQHWFGDQLLAHAVGLPRVL 219 ++FG +VQY + Q LA AV VL Sbjct: 284 SQFGENNVQYQGSEDILNTQSLAKAVSKNGVL 315 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.0 bits (42), Expect = 9.0 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -2 Query: 522 ESFQYVSSSLNERWDAGS 469 ESF Y L RW G+ Sbjct: 135 ESFSYHKQKLRLRWGTGA 152 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 9.0 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 522 ESFQYVSSSLNERWDAG 472 ESF Y + +W+AG Sbjct: 157 ESFGYTMRDIRYKWNAG 173 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 506 TY*KDSRASPGCSRQS 553 T+ KD R PG RQS Sbjct: 366 TWYKDGRQLPGTGRQS 381 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 506 TY*KDSRASPGCSRQS 553 T+ KD R PG RQS Sbjct: 366 TWYKDGRQLPGTGRQS 381 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,620 Number of Sequences: 438 Number of extensions: 3304 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17237673 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -