BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20735 (738 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15870| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 6e-22 SB_54666| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 9e-16 SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_53794| Best HMM Match : Mito_carr (HMM E-Value=0.00014) 55 5e-08 SB_18218| Best HMM Match : Mito_carr (HMM E-Value=0) 52 6e-07 SB_11756| Best HMM Match : Mito_carr (HMM E-Value=0) 44 2e-04 SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) 42 7e-04 SB_31912| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45) 40 0.002 SB_4905| Best HMM Match : Mito_carr (HMM E-Value=3.3e-13) 40 0.002 SB_46794| Best HMM Match : Mito_carr (HMM E-Value=1.12104e-44) 39 0.005 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 39 0.005 SB_3139| Best HMM Match : Mito_carr (HMM E-Value=0) 38 0.011 SB_49149| Best HMM Match : Mito_carr (HMM E-Value=4.7e-22) 37 0.015 SB_36589| Best HMM Match : Mito_carr (HMM E-Value=0) 37 0.015 SB_54004| Best HMM Match : Mito_carr (HMM E-Value=0) 37 0.020 SB_51010| Best HMM Match : Mito_carr (HMM E-Value=0) 36 0.034 SB_23056| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_52834| Best HMM Match : Mito_carr (HMM E-Value=6.7e-34) 36 0.045 SB_42958| Best HMM Match : Mito_carr (HMM E-Value=4.60046e-42) 36 0.045 SB_47003| Best HMM Match : Mito_carr (HMM E-Value=2.3e-29) 35 0.060 SB_46795| Best HMM Match : Mito_carr (HMM E-Value=0) 34 0.10 SB_45843| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_34206| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_8951| Best HMM Match : Mito_carr (HMM E-Value=0) 33 0.24 SB_16884| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_9806| Best HMM Match : Mito_carr (HMM E-Value=0.061) 33 0.32 SB_51922| Best HMM Match : Mito_carr (HMM E-Value=0) 32 0.42 SB_17535| Best HMM Match : C2 (HMM E-Value=2.7e-14) 31 0.74 SB_3432| Best HMM Match : 7tm_1 (HMM E-Value=3.8e-28) 31 0.74 SB_5442| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_16877| Best HMM Match : Mito_carr (HMM E-Value=0) 31 0.97 SB_32253| Best HMM Match : Mito_carr (HMM E-Value=1.6e-31) 30 1.7 SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) 30 2.3 SB_29345| Best HMM Match : Mito_carr (HMM E-Value=0) 30 2.3 SB_23920| Best HMM Match : Mito_carr (HMM E-Value=0.00039) 30 2.3 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_45532| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-40) 29 3.0 SB_43597| Best HMM Match : TP2 (HMM E-Value=1.7) 29 3.0 SB_39097| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_37560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_27872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_6736| Best HMM Match : efhand (HMM E-Value=2.6e-21) 29 5.2 SB_12356| Best HMM Match : zf-CCHC (HMM E-Value=0.018) 29 5.2 SB_31675| Best HMM Match : zf-CCHC (HMM E-Value=0.012) 28 6.9 SB_13696| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_28925| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 9.1 >SB_15870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 101 bits (242), Expect = 6e-22 Identities = 49/82 (59%), Positives = 59/82 (71%), Gaps = 1/82 (1%) Frame = +1 Query: 259 GISAAVSKTAVAPIERIKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGN 435 G +A +SKTA APIER+KLL+Q Q + K D YKG++D R + +G LSFWRGN Sbjct: 17 GAAAIISKTAAAPIERVKLLVQNQDEMLKAGRLDHPYKGVIDCTSRTYRSEGFLSFWRGN 76 Query: 436 FANVIRYFPTQALNFAFKDKYK 501 AN IRYFPTQALNFAFKD+ K Sbjct: 77 LANCIRYFPTQALNFAFKDQVK 98 Score = 58.0 bits (134), Expect = 7e-09 Identities = 29/51 (56%), Positives = 36/51 (70%), Gaps = 2/51 (3%) Frame = +3 Query: 591 SLCFVYPLDFARTRLAAD--VGKGDGQREFSGLGNCISKIFKSDGLIGLYR 737 SL FVY LD+ RTRLA D VGK G+R+F+G+ + K SDGL+GLYR Sbjct: 127 SLFFVYSLDYCRTRLANDAKVGKKGGERQFNGMIDVYKKTIASDGLVGLYR 177 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/49 (32%), Positives = 30/49 (61%) Frame = +1 Query: 361 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 507 +YKG +D ++I K++G +S +G AN++R + F DK+K++ Sbjct: 248 KYKGSIDCTIQILKKEGAMSLMKGAGANILRGMAGAGVLAGF-DKFKEL 295 >SB_54666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 81.0 bits (191), Expect = 9e-16 Identities = 37/86 (43%), Positives = 61/86 (70%) Frame = +1 Query: 247 LPGGGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 426 L GGI+ AVS+T+V+P+ER+K+LLQ+Q + ++KG++ ++I KE+G+L ++ Sbjct: 38 LLAGGIAGAVSRTSVSPLERVKILLQIQ------VKNPKFKGVLPTLIQIGKEEGILGYF 91 Query: 427 RGNFANVIRYFPTQALNFAFKDKYKQ 504 +GN NVIR FP A+ FA ++YK+ Sbjct: 92 KGNGTNVIRIFPYSAVQFAAYEEYKK 117 >SB_28512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 67.7 bits (158), Expect = 9e-12 Identities = 37/85 (43%), Positives = 51/85 (60%) Frame = +1 Query: 253 GGGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 432 GGG A VS+TA AP++R+K+LLQVQ A+ GIV F + +E G+ S WRG Sbjct: 142 GGGALAGVSRTATAPLDRLKVLLQVQ------ASSTNRFGIVSGFKMMLREGGIKSLWRG 195 Query: 433 NFANVIRYFPTQALNFAFKDKYKQV 507 N ANVI+ P + F +K K++ Sbjct: 196 NGANVIKIAPESGIKFFAYEKAKKL 220 Score = 37.9 bits (84), Expect = 0.008 Identities = 21/85 (24%), Positives = 45/85 (52%) Frame = +1 Query: 247 LPGGGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 426 L G ++ S+T++ P+E +K L ++ + Y+G++ A I +++G+ SF+ Sbjct: 234 LLAGSMAGVASQTSIYPLEVLKTRLAIRKTGQ-------YRGLLHAASVIYQKEGIRSFY 286 Query: 427 RGNFANVIRYFPTQALNFAFKDKYK 501 RG F +++ P ++ A + K Sbjct: 287 RGLFPSLLGIIPYAGIDLAVYETLK 311 Score = 33.9 bits (74), Expect = 0.14 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 606 YPLDFARTRLAADV-GKGDGQREFSGLGNCISKIFKSDGLIGLYR 737 YPL RTRL A KG GQ + + + + KI DG GLYR Sbjct: 346 YPLSLVRTRLQAQAREKGGGQGD--NMVSVLRKIITEDGFKGLYR 388 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +3 Query: 603 VYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYR 737 +YPL+ +TRLA + GQ + GL + S I++ +G+ YR Sbjct: 248 IYPLEVLKTRLAI---RKTGQ--YRGLLHAASVIYQKEGIRSFYR 287 >SB_53794| Best HMM Match : Mito_carr (HMM E-Value=0.00014) Length = 76 Score = 55.2 bits (127), Expect = 5e-08 Identities = 28/58 (48%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = +1 Query: 259 GISAAVSKTAVAPIERIKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWR 429 G +A +SKTA APIER+KLL+Q Q + K YKG+VD +R + +G+ SFWR Sbjct: 18 GAAAIISKTAAAPIERVKLLVQNQDEMLKAGRLSSPYKGVVDCTMRTYRAEGIGSFWR 75 >SB_18218| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 375 Score = 51.6 bits (118), Expect = 6e-07 Identities = 24/76 (31%), Positives = 43/76 (56%) Frame = +1 Query: 256 GGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGN 435 GG SA ++++ +P+E +K+L QV + G++ F + K +G+ +FW+GN Sbjct: 65 GGTSAVLARSLTSPLEVVKVLAQV-------GTQEAKPGLIRTFASVYKREGIKAFWKGN 117 Query: 436 FANVIRYFPTQALNFA 483 + IR FP A+ +A Sbjct: 118 GVSCIRLFPYSAVQYA 133 Score = 42.3 bits (95), Expect = 4e-04 Identities = 25/69 (36%), Positives = 37/69 (53%) Frame = +1 Query: 256 GGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGN 435 G S ++ V P E IK L VQHV+K A YKG+ A I +E+G+L+ ++G Sbjct: 159 GTSSTLIAMVTVYPCEVIKTRLTVQHVNKSNA---HYKGMRHALKTILREEGILALYKGV 215 Query: 436 FANVIRYFP 462 + + FP Sbjct: 216 TPSFLGLFP 224 >SB_11756| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 274 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/75 (28%), Positives = 41/75 (54%) Frame = +1 Query: 256 GGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGN 435 G ++ +AP++ +K+ LQ+Q +K+ + Y+G VD V++ + +GL ++GN Sbjct: 40 GSVAGLAQVPLIAPVDLVKIKLQMQTEAKR-STRSVYRGPVDCLVKLYRSRGLAGCFQGN 98 Query: 436 FANVIRYFPTQALNF 480 +R P A+ F Sbjct: 99 TVTAVRDIPGFAVYF 113 Score = 37.9 bits (84), Expect = 0.008 Identities = 25/78 (32%), Positives = 40/78 (51%) Frame = +1 Query: 247 LPGGGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 426 L GG + VS + P + IK +Q + RYKG++D ++ KE+G++ F Sbjct: 136 LMAGGFAGVVSWASTFPFDVIKSRIQADGNLGKF----RYKGMMDCALQSYKEEGMIVFT 191 Query: 427 RGNFANVIRYFPTQALNF 480 RG + ++R F Q L F Sbjct: 192 RGIWPTLLRGF-LQVLRF 208 >SB_50582| Best HMM Match : Mito_carr (HMM E-Value=2.1e-23) Length = 1026 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/84 (26%), Positives = 41/84 (48%) Frame = +1 Query: 262 ISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFA 441 I A TAV PI+ +K +Q Q + A++ YK +D F ++ + +G + +RG Sbjct: 922 IKKATGATAVYPIDLVKTRMQNQRAV--LEAEKVYKNSIDCFFKVVRNEGPIGLYRGLLP 979 Query: 442 NVIRYFPTQALNFAFKDKYKQVSS 513 ++ P +A+ D + + S Sbjct: 980 QLLGVSPEKAIKLTTNDFVRGIFS 1003 Score = 35.9 bits (79), Expect = 0.034 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +3 Query: 588 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYR 737 T VYP+D +TR+ + ++ + +C K+ +++G IGLYR Sbjct: 926 TGATAVYPIDLVKTRMQNQRAVLEAEKVYKNSIDCFFKVVRNEGPIGLYR 975 >SB_31912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 3/75 (4%) Frame = +1 Query: 217 PRRSGRVR*GLPGGGISAAVSKTAVAPIERIKLLLQVQ---HVSKQIAADQRYKGIVDAF 387 P + V L G +S +SK + P + IK +QVQ + Q+Y G+ D F Sbjct: 23 PYKPADVIESLTCGALSGMISKAVILPFDIIKKRIQVQGFEEARQSFGRVQQYDGVKDCF 82 Query: 388 VRIPKEQGLLSFWRG 432 I KE+G + ++G Sbjct: 83 RTILKEEGAMGLFKG 97 >SB_1246| Best HMM Match : Mito_carr (HMM E-Value=1.4013e-45) Length = 773 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/48 (29%), Positives = 30/48 (62%) Frame = +1 Query: 361 RYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 504 +Y G+ +I +++GL +++GN N++R P A+ FA +++K+ Sbjct: 590 KYSGVGGTLAKIYRDEGLYGYFKGNGTNIVRIVPYTAVQFAAYEEFKK 637 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +3 Query: 606 YPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYR 737 YPLD R R+ + +G+G ++S + I +S+G IGL++ Sbjct: 700 YPLDVVRRRMQME--RGEGMFKYSSTWDGFKVIVRSEGFIGLFK 741 >SB_4905| Best HMM Match : Mito_carr (HMM E-Value=3.3e-13) Length = 577 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/59 (38%), Positives = 33/59 (55%) Frame = +1 Query: 256 GGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 432 G S ++ V P E IK L VQHV+K A YKG+ A I +E+G+L+ ++G Sbjct: 428 GTSSTLIAMVTVYPCEVIKTRLTVQHVNKSNA---HYKGMRHALKTILREEGILALYKG 483 >SB_46794| Best HMM Match : Mito_carr (HMM E-Value=1.12104e-44) Length = 192 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/84 (25%), Positives = 37/84 (44%) Frame = +1 Query: 262 ISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFA 441 IS + A P++ K +Q + I YKG +D RI + +G+ + W+G Sbjct: 102 ISGLATTVASMPVDIAKTRIQNMRI---IDGKPEYKGTMDVLARIVRNEGVFALWKGFTP 158 Query: 442 NVIRYFPTQALNFAFKDKYKQVSS 513 R P L F F ++ + ++ Sbjct: 159 YYFRIGPHTVLTFIFLEQLNRAAN 182 Score = 35.1 bits (77), Expect = 0.060 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +1 Query: 364 YKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 507 Y + +A R+ KE+G+L+ WRG +R A A + KQ+ Sbjct: 35 YTNVFNALYRMSKEEGVLTLWRGYIPTAVRAMVVNAAQLATYSQAKQL 82 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/72 (27%), Positives = 33/72 (45%) Frame = +1 Query: 256 GGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGN 435 GGI+ +S P++ +K Q + +Y G D +I G+ +F +G Sbjct: 364 GGIAGTLSWILTYPVDMVKSCYQADGRTNSGKPQYKYNGYADCVKKIYISGGVSAFGQGL 423 Query: 436 FANVIRYFPTQA 471 A ++R FPT A Sbjct: 424 LATILRGFPTNA 435 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +3 Query: 591 SLCFVYPLDFARTRLAAD--VGKGDGQREFSGLGNCISKIFKSDGL 722 S YP+D ++ AD G Q +++G +C+ KI+ S G+ Sbjct: 371 SWILTYPVDMVKSCYQADGRTNSGKPQYKYNGYADCVKKIYISGGV 416 >SB_3139| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 276 Score = 37.5 bits (83), Expect = 0.011 Identities = 22/90 (24%), Positives = 45/90 (50%), Gaps = 9/90 (10%) Frame = +1 Query: 259 GISAAVSKTAVAPIERIKLLLQVQHVSKQIAA---------DQRYKGIVDAFVRIPKEQG 411 GI+A++++ A PI+ K+ LQ+Q S +A+ D Y+G++ V + K +G Sbjct: 22 GIAASIAEAATIPIDTAKVRLQIQGESAVMASIAQGVRTTHDAHYRGMLGTMVTLFKTEG 81 Query: 412 LLSFWRGNFANVIRYFPTQALNFAFKDKYK 501 + + ++G + R ++ D+ K Sbjct: 82 MKTMYKGLIPGIHRQLCFASIRIGLYDQVK 111 >SB_49149| Best HMM Match : Mito_carr (HMM E-Value=4.7e-22) Length = 95 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/45 (31%), Positives = 28/45 (62%) Frame = +1 Query: 346 IAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 480 I ++Y G+++AF RI +++G+ +F+RG +I P ++F Sbjct: 19 ITQKKKYTGLINAFTRIYRDEGMRTFYRGYVPTLIGIMPYAGISF 63 Score = 33.1 bits (72), Expect = 0.24 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = +3 Query: 588 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYR 737 T+ YPLD R RLA +++++GL N ++I++ +G+ YR Sbjct: 2 TAALLTYPLDMVRARLAI-----TQKKKYTGLINAFTRIYRDEGMRTFYR 46 >SB_36589| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 264 Score = 37.1 bits (82), Expect = 0.015 Identities = 22/88 (25%), Positives = 43/88 (48%), Gaps = 1/88 (1%) Frame = +1 Query: 244 GLPGGGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-LS 420 G GG++ AVS+T P++ ++ +Q ++ + +Y ++ V + K+ G+ Sbjct: 175 GFVCGGVAGAVSQTIAYPLDVVRRRMQ---LAGAVPDGHKYNTCINTLVNVYKDDGIRRG 231 Query: 421 FWRGNFANVIRYFPTQALNFAFKDKYKQ 504 +RG N +R P A+ F + KQ Sbjct: 232 LYRGLSINYLRVCPQVAIMFGVYEVTKQ 259 Score = 36.3 bits (80), Expect = 0.026 Identities = 16/45 (35%), Positives = 29/45 (64%) Frame = +1 Query: 373 IVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 507 ++ AF I + +GLL++++GN A ++R FP A+ F + Y +V Sbjct: 13 VLTAFRAIYRNEGLLAYFKGNGAMMLRTFPYGAVQFLSYEHYSKV 57 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = +3 Query: 588 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYR 737 T+ YPLD R+RLA V + G + CIS K G LY+ Sbjct: 77 TACACTYPLDMVRSRLAFQVAQDQGYTTITQTIRCIS--VKEGGPKALYK 124 >SB_54004| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 309 Score = 36.7 bits (81), Expect = 0.020 Identities = 20/78 (25%), Positives = 39/78 (50%) Frame = +1 Query: 247 LPGGGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 426 L G +S + A P++ +K+ LQ + K +KG +D F++ + +GL + Sbjct: 24 LIAGSVSGMLGCAAGQPLDLLKVRLQAMNQVKP-GETAPFKGAMDCFMKTVRLEGLRGLY 82 Query: 427 RGNFANVIRYFPTQALNF 480 +G + ++ P+ AL F Sbjct: 83 KGMLSPLLMATPSTALTF 100 Score = 28.3 bits (60), Expect = 6.9 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 609 PLDFARTRLAADVGKGDGQRE-FSGLGNCISKIFKSDGLIGLYR 737 PLD + RL A G+ F G +C K + +GL GLY+ Sbjct: 40 PLDLLKVRLQAMNQVKPGETAPFKGAMDCFMKTVRLEGLRGLYK 83 >SB_51010| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 306 Score = 35.9 bits (79), Expect = 0.034 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +1 Query: 259 GISAAVSKTAVA-PIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 432 G+S+ V +A+A P + +K+ Q + + I YK + AF +I K++G L W G Sbjct: 121 GVSSGVIGSAIATPTDLVKIRFQAVKIGETIP----YKNMFHAFYKIAKKEGFLGLWTG 175 Score = 31.1 bits (67), Expect = 0.97 Identities = 24/102 (23%), Positives = 45/102 (44%), Gaps = 2/102 (1%) Frame = +1 Query: 154 AATPTSTYSPSEDHI--IEQNVEPRRSGRVR*GLPGGGISAAVSKTAVAPIERIKLLLQV 327 AA + T P+ DH + N E R G V L ++ V+ +P++ ++ Sbjct: 183 AACISGTQIPTYDHTKHLLLNAELMREG-VALHLASALVAGFVATCVASPVDIVRTRFMT 241 Query: 328 QHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIR 453 Q + Y+G +D + + +G+L+ ++G F N R Sbjct: 242 QPKDTK-GRPLVYQGTLDCIYKTVRHEGILALYKGFFPNWTR 282 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 597 CFVYPLDFARTRLAADVGKGDGQR-EFSGLGNCISKIFKSDGLIGLYR 737 C P+D RTR G+ + G +CI K + +G++ LY+ Sbjct: 227 CVASPVDIVRTRFMTQPKDTKGRPLVYQGTLDCIYKTVRHEGILALYK 274 >SB_23056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 35.5 bits (78), Expect = 0.045 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 376 VDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYK 501 +DA ++IP+ +GL S WRG ++ P + F D+ K Sbjct: 64 IDALIKIPRYEGLSSLWRGLPPTMVMAVPNTVIYFTLYDQLK 105 >SB_52834| Best HMM Match : Mito_carr (HMM E-Value=6.7e-34) Length = 302 Score = 35.5 bits (78), Expect = 0.045 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = +3 Query: 588 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYR 737 T+ V PLD +TRL + + G+ ++G+ +C KI+ ++GL Y+ Sbjct: 218 TASVAVNPLDVIKTRLQL-LNRPQGEPNYNGIIDCAKKIYSNEGLAAFYK 266 Score = 34.3 bits (75), Expect = 0.10 Identities = 20/72 (27%), Positives = 36/72 (50%) Frame = +1 Query: 247 LPGGGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 426 L G ++ + AV P++ IK LQ+ + + + Y GI+D +I +GL +F+ Sbjct: 209 LGAGCLAGMTASVAVNPLDVIKTRLQLLNRPQ---GEPNYNGIIDCAKKIYSNEGLAAFY 265 Query: 427 RGNFANVIRYFP 462 +G +I P Sbjct: 266 KGAVPRMIVIAP 277 >SB_42958| Best HMM Match : Mito_carr (HMM E-Value=4.60046e-42) Length = 247 Score = 35.5 bits (78), Expect = 0.045 Identities = 18/47 (38%), Positives = 28/47 (59%) Frame = +1 Query: 292 APIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRG 432 AP ER+K LLQVQ K+ RY+G+ D +++ + GL ++G Sbjct: 179 APTERVKCLLQVQ---KESGTKARYQGLGDCLLQVYRTGGLRGVFKG 222 Score = 29.1 bits (62), Expect = 3.9 Identities = 11/39 (28%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = +3 Query: 624 RTRLAADVGKGDGQR-EFSGLGNCISKIFKSDGLIGLYR 737 R + V K G + + GLG+C+ +++++ GL G+++ Sbjct: 183 RVKCLLQVQKESGTKARYQGLGDCLLQVYRTGGLRGVFK 221 >SB_47003| Best HMM Match : Mito_carr (HMM E-Value=2.3e-29) Length = 868 Score = 35.1 bits (77), Expect = 0.060 Identities = 19/71 (26%), Positives = 33/71 (46%) Frame = +1 Query: 295 PIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 474 PI+ K +QVQ + Q A +Y+ + A I + G+ ++G A ++R P Sbjct: 221 PIDLFKSKMQVQIIRAQSGAPIQYRNVFHAGYTIAQTYGIRGCYQGLSATLVRNIPANGF 280 Query: 475 NFAFKDKYKQV 507 F F + K + Sbjct: 281 FFGFYEFTKNL 291 >SB_46795| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 328 Score = 34.3 bits (75), Expect = 0.10 Identities = 19/72 (26%), Positives = 34/72 (47%) Frame = +1 Query: 247 LPGGGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFW 426 L G I+ + + P++R+K +LQ++ + Y G VD RI +E G+ + Sbjct: 141 LAAGMIAGVATSFVLTPLDRVKCILQIE----KAFGGSSYGGPVDCLRRIYREAGVRGVY 196 Query: 427 RGNFANVIRYFP 462 +G +R P Sbjct: 197 KGISVTAMRDIP 208 Score = 31.5 bits (68), Expect = 0.74 Identities = 18/76 (23%), Positives = 33/76 (43%) Frame = +1 Query: 256 GGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGN 435 G + A + P++ IK+ LQ + K YK D F +I + +G+ +RG Sbjct: 45 GSAAGAAANLVGFPLDTIKVRLQAMPLPKP-GEPWMYKNSFDCFFKIIRNEGVYYLFRGV 103 Query: 436 FANVIRYFPTQALNFA 483 ++ P + F+ Sbjct: 104 TVPILNSIPNTTVLFS 119 >SB_45843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = +1 Query: 394 IPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 507 +P+E L W G F++VI F A+N AF+++YK++ Sbjct: 272 LPREVYLFYSWIGAFSSVINPFIYGAMNPAFREEYKKI 309 >SB_34206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 33.9 bits (74), Expect = 0.14 Identities = 19/50 (38%), Positives = 29/50 (58%) Frame = +1 Query: 394 IPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVSSAALTRRRSSG 543 +P+E +L W G ++VI F A+N F+D+YK++ L R R SG Sbjct: 139 LPREVYVLYTWLGTLSSVINPFIYGAMNPVFRDEYKKL----LRRMRRSG 184 >SB_8951| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 434 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/69 (26%), Positives = 36/69 (52%) Frame = +1 Query: 256 GGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGN 435 G + V+ + P++ ++ L VQ +S + ++ Y GIV A RI E+G+ ++G Sbjct: 35 GATAGVVATASTHPLDVVRARLTVQDMSTRSISN--YTGIVSALRRIHIEEGIRGLYKGL 92 Query: 436 FANVIRYFP 462 +++ P Sbjct: 93 VPSLVSIAP 101 >SB_16884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 32.7 bits (71), Expect = 0.32 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +3 Query: 594 LCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYR 737 +C +P ++ +T+L D + + + G +C+ K K G++GLYR Sbjct: 55 ICCTFPTEYVKTQLQLD--EKAAKPIYRGPIDCVKKTVKGHGVLGLYR 100 Score = 32.3 bits (70), Expect = 0.42 Identities = 21/76 (27%), Positives = 35/76 (46%) Frame = +1 Query: 256 GGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGN 435 GGI+ + P E +K LQ+ + AA Y+G +D + K G+L +RG Sbjct: 47 GGIAGGLEICCTFPTEYVKTQLQLD----EKAAKPIYRGPIDCVKKTVKGHGVLGLYRGL 102 Query: 436 FANVIRYFPTQALNFA 483 + + P ++ FA Sbjct: 103 SSLLYGSVPKASVRFA 118 >SB_9806| Best HMM Match : Mito_carr (HMM E-Value=0.061) Length = 114 Score = 32.7 bits (71), Expect = 0.32 Identities = 18/60 (30%), Positives = 31/60 (51%) Frame = +1 Query: 250 PGGGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWR 429 P G+S +KT AP+ER+K+L Q Q+ + + A I K++GL +++ Sbjct: 60 PPLGLSTCCAKTTTAPLERLKILFQAQN------KHYKNMSVFGALKAIYKKEGLQGYYK 113 >SB_51922| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 200 Score = 32.3 bits (70), Expect = 0.42 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +3 Query: 588 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSD-GLIGLYR 737 T+ YPLD R+RLA V + + G+ + +IF ++ G++ LYR Sbjct: 11 TACSCTYPLDIVRSRLAFQVA---DEHTYCGICQTVKQIFMTEGGMVALYR 58 Score = 29.1 bits (62), Expect = 3.9 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +3 Query: 588 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGL-IGLYR 737 TS YPLD R R+ DG + +S N ++ DG+ GLYR Sbjct: 119 TSQTLAYPLDVVRRRMQLAGTVADGHK-YSTCINTFISVYTEDGIRRGLYR 168 >SB_17535| Best HMM Match : C2 (HMM E-Value=2.7e-14) Length = 553 Score = 31.5 bits (68), Expect = 0.74 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Frame = +1 Query: 220 RRSGRVR*-GLPGGGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRI 396 R+ GR R L G S+ VA ER +L+ Q Q +D RY+G +D+F Sbjct: 258 RQHGRGRGITLEGNDRGKRQSRQTVACPERCGVLMASQGKRGQYMSDARYRGHLDSFRGD 317 Query: 397 PKEQGLLSFWRGN 435 + +G L +RG+ Sbjct: 318 ARYRGHLDSFRGD 330 >SB_3432| Best HMM Match : 7tm_1 (HMM E-Value=3.8e-28) Length = 343 Score = 31.5 bits (68), Expect = 0.74 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = +1 Query: 394 IPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVSSAALTRRRSSGV 546 +P+E L + G ++VI F A+N F+++YK+V A R R+S V Sbjct: 263 LPRELYFLYTYVGVLSSVINPFIYGAMNPMFREEYKKVFRIATFRGRNSAV 313 >SB_5442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 31.5 bits (68), Expect = 0.74 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Frame = +1 Query: 256 GGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYK-GIVDAFVRIPKEQGLLSFWRG 432 G +A + P E IK LQ QH + I+ K G++D ++I + G +RG Sbjct: 113 GSGAAFFMSFVLCPAELIKCRLQAQHQTNLISGMAGPKSGVIDVTMQIIRNDGFQGLFRG 172 Query: 433 NFANVIRYFP 462 A R P Sbjct: 173 MTATWAREVP 182 >SB_16877| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 1024 Score = 31.1 bits (67), Expect = 0.97 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +3 Query: 588 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLY 734 TSLC YP + ARTRL + G++++ + + + +G GLY Sbjct: 946 TSLC--YPHEVARTRLRQQESEFLGRQKYRSFFQTLGTVLREEGWRGLY 992 Score = 30.7 bits (66), Expect = 1.3 Identities = 22/102 (21%), Positives = 43/102 (42%) Frame = +1 Query: 175 YSPSEDHIIEQNVEPRRSGRVR*GLPGGGISAAVSKTAVAPIERIKLLLQVQHVSKQIAA 354 Y + +++ + + RR V + GIS ++ + P E + L+ Q + Sbjct: 911 YERLKAELLKLHYKSRRDFHVVECMLAAGISKCIATSLCYPHEVARTRLRQQE--SEFLG 968 Query: 355 DQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNF 480 Q+Y+ + +E+G + G +VIR P A+ F Sbjct: 969 RQKYRSFFQTLGTVLREEGWRGLYGGLGTHVIRQVPNTAIMF 1010 >SB_32253| Best HMM Match : Mito_carr (HMM E-Value=1.6e-31) Length = 233 Score = 30.3 bits (65), Expect = 1.7 Identities = 21/80 (26%), Positives = 37/80 (46%) Frame = +1 Query: 244 GLPGGGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSF 423 G GG ++ V +T P++ I L +Q Q + KG + G F Sbjct: 108 GFLAGGCASIVGQTITVPVDIISQKLMIQ---GQGDRKVKLKGARILIRETFHQHGPGGF 164 Query: 424 WRGNFANVIRYFPTQALNFA 483 ++G FA+++ Y P+ A+ +A Sbjct: 165 YKGYFASLMTYAPSSAIWWA 184 >SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 203 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/75 (26%), Positives = 33/75 (44%) Frame = +1 Query: 256 GGISAAVSKTAVAPIERIKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGN 435 G + A+ PIE IK LQ+ Y+G++ + KE+G+ +F+R Sbjct: 4 GACATVFHDGAMNPIEVIKQRLQMY--------GSPYRGVIHCATSVFKEEGIRAFYRSY 55 Query: 436 FANVIRYFPTQALNF 480 + P Q L+F Sbjct: 56 TTQLSMNIPFQTLHF 70 >SB_29345| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 313 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 606 YPLDFARTRLAADVGKGDGQRE-FSGLGNCISKIFKSDGLIGLYR 737 +PLD + RL G++ F+G +C K +++G GLY+ Sbjct: 45 HPLDTIKVRLQTMPRPKPGEKPMFTGTFDCAMKTIRNEGFFGLYK 89 >SB_23920| Best HMM Match : Mito_carr (HMM E-Value=0.00039) Length = 54 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +1 Query: 370 GIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQV 507 G+V + G +RGN A ++R P ++ F ++YK++ Sbjct: 1 GVVHVLTQTYTTNGFTGLFRGNSATMMRVVPYASIQFTSHEQYKKL 46 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 645 HRRRDGYVRSRGGTRSTERWLRRHHRRPDYQRSNARTAS-SC 523 + RD RS+ +R++ RWL R R+P S+ R++S SC Sbjct: 6 NNNRDN-TRSQVRSRNSNRWLLRQQRQPQRHLSHKRSSSNSC 46 >SB_45532| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-40) Length = 368 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +1 Query: 394 IPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVSSAALTRRRSSG 543 +P+E +L + G ++VI F A+N FK++YK++ T R G Sbjct: 267 LPREVYVLYSFLGGLSSVINPFIYGAMNPIFKEQYKKILRPRCTGRIVEG 316 >SB_43597| Best HMM Match : TP2 (HMM E-Value=1.7) Length = 272 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -3 Query: 682 RPENSRWPSPLPTSAARRVRAKSRGYTK 599 RP +SR S P+SA+RR ++SRG + Sbjct: 221 RPSSSRPSSARPSSASRRASSRSRGLAR 248 >SB_39097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 315 AAPSTARQQADRRRPALQGYRRR-LRPHPQGAGSP 416 A+ S RQQ R RP +GY +R R +P+ SP Sbjct: 83 ASGSNQRQQQARGRPQARGYNQRSRRGYPRARASP 117 >SB_37560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 706 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 315 AAPSTARQQADRRRPALQGYRRR-LRPHPQGAGSP 416 A+ S RQQ R RP +GY +R R +P+ SP Sbjct: 183 ASGSNQRQQQARGRPQARGYNQRSRRGYPRARASP 217 >SB_27872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 975 Score = 28.7 bits (61), Expect = 5.2 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +1 Query: 406 QGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVSSAALTRRRSS 540 Q LLS +A+ I Y+P LN +D +S R+RSS Sbjct: 412 QFLLSIADSLYADAIHYWPLDQLNITLRDSPLPHASLKTLRKRSS 456 >SB_6736| Best HMM Match : efhand (HMM E-Value=2.6e-21) Length = 198 Score = 28.7 bits (61), Expect = 5.2 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +1 Query: 247 LPGGGISAAVSKTAVAPIERIKLLLQ 324 + GG++ S+T AP+E++K++ Q Sbjct: 173 MSAGGVAGVASRTLTAPLEKMKIIAQ 198 >SB_12356| Best HMM Match : zf-CCHC (HMM E-Value=0.018) Length = 404 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 315 AAPSTARQQADRRRPALQGYRRR-LRPHPQGAGSP 416 A+ S RQQ R RP +GY +R R +P+ SP Sbjct: 261 ASGSNQRQQQARGRPQARGYNQRSRRGYPRARASP 295 >SB_31675| Best HMM Match : zf-CCHC (HMM E-Value=0.012) Length = 550 Score = 28.3 bits (60), Expect = 6.9 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +3 Query: 315 AAPSTARQQADRRRPALQGYRRR-LRPHPQGAGSP 416 A+ S RQQ R RP GY +R R +P+ SP Sbjct: 84 ASGSNQRQQQARGRPQASGYNQRSRRGYPRARASP 118 >SB_13696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 27.9 bits (59), Expect = 9.1 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 5/82 (6%) Frame = +1 Query: 121 ELVFRDPPSA----CAATPTSTYSPSEDHIIEQNVEPRRSGRVR*GLPGGGISAAVSKTA 288 E + RDP + A+P S I EQNVE S + G+ G + T Sbjct: 269 EALTRDPKESDTNVSRASPDSHLQTVISEIREQNVELVESSPIEAGVDGETPAPDEKSTD 328 Query: 289 VAPIERIKLLLQVQHVSK-QIA 351 VAPI + LQ + ++ QIA Sbjct: 329 VAPISEVADALQEKEENEPQIA 350 >SB_28925| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 792 Score = 27.9 bits (59), Expect = 9.1 Identities = 14/52 (26%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Frame = +1 Query: 43 ISKKAHTYPLCSRDYEITPNLLFKNQELV----FRDPPSACAATPTSTYSPS 186 ++ ++ Y C + E +P + + ++D SAC A P TY PS Sbjct: 106 LTDESELYGYCQSNGEWSPAMYTSRHRCMCHAGYQDTVSACTACPRGTYKPS 157 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,273,606 Number of Sequences: 59808 Number of extensions: 436640 Number of successful extensions: 1408 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 1247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1400 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -