BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20733 (655 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 25 0.48 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.6 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 4.5 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 7.9 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 25.4 bits (53), Expect = 0.48 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -2 Query: 294 ISFGSFLHFRKHHELTSSGKKVLSSPLYATLILGLPPSLTTS 169 +S + H R+H + T + SS +L + +PPS+ S Sbjct: 23 VSVAGYKHSRRHRDFTVAESYDASSSNSDSLSMTIPPSIDRS 64 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/35 (34%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = -2 Query: 624 TPGQSGSPCDCQ---SPHLPSGCRRRWISPRRYHP 529 TP P + Q H P+G + WI+ RY P Sbjct: 777 TPFDPDVPIELQIQKQSHTPNGIVKTWIAHDRYLP 811 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 352 QRQATKDAGTISGLNVLRIINEPTAAAIAYG 444 Q +A K A + N II+EPT YG Sbjct: 353 QAEAEKHAAMLYQYNFNIIISEPTERISPYG 383 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 7.9 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = -2 Query: 261 HHELTSSGKKVLSSPLYA-TLILGLPP 184 HH SG S+PL A TL GL P Sbjct: 511 HHVAPPSGHHASSAPLLAATLAGGLCP 537 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,148 Number of Sequences: 438 Number of extensions: 3831 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -