BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20731 (713 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g15010.1 68418.m01760 pentatricopeptide (PPR) repeat-containi... 29 4.0 At2g43180.4 68415.m05365 expressed protein 29 4.0 At2g43180.3 68415.m05363 expressed protein 29 4.0 At2g43180.2 68415.m05364 expressed protein 29 4.0 At2g43180.1 68415.m05362 expressed protein 29 4.0 >At5g15010.1 68418.m01760 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 532 Score = 28.7 bits (61), Expect = 4.0 Identities = 18/54 (33%), Positives = 27/54 (50%) Frame = -2 Query: 352 AMLLILKMRCISNFSVSIENSFK*VYKTRYYCKCSQISRVLLTFTAQKKFSRQL 191 A LI +MR FS S+ NS + R YC + + + TF A K+F ++ Sbjct: 140 AWTLIDEMR---KFSPSLVNSQTLLIMIRKYCAVHDVGKAINTFHAYKRFKLEM 190 >At2g43180.4 68415.m05365 expressed protein Length = 466 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/50 (28%), Positives = 30/50 (60%) Frame = +3 Query: 501 VYVSEPLIKSHSYLYPGGSADVLSVDSLFSVDQVSVMLTIWARIGRVRSL 650 + + E LI++ ++ G ADVLSVDSL S +++ ++ + ++ ++ Sbjct: 230 ISLEESLIRARAFTDAG--ADVLSVDSLVSREEMKAFCNVYPLVPKLANM 277 >At2g43180.3 68415.m05363 expressed protein Length = 478 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/50 (28%), Positives = 30/50 (60%) Frame = +3 Query: 501 VYVSEPLIKSHSYLYPGGSADVLSVDSLFSVDQVSVMLTIWARIGRVRSL 650 + + E LI++ ++ G ADVLSVDSL S +++ ++ + ++ ++ Sbjct: 230 ISLEESLIRARAFTDAG--ADVLSVDSLVSREEMKAFCNVYPLVPKLANM 277 >At2g43180.2 68415.m05364 expressed protein Length = 451 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/50 (28%), Positives = 30/50 (60%) Frame = +3 Query: 501 VYVSEPLIKSHSYLYPGGSADVLSVDSLFSVDQVSVMLTIWARIGRVRSL 650 + + E LI++ ++ G ADVLSVDSL S +++ ++ + ++ ++ Sbjct: 230 ISLEESLIRARAFTDAG--ADVLSVDSLVSREEMKAFCNVYPLVPKLANM 277 >At2g43180.1 68415.m05362 expressed protein Length = 479 Score = 28.7 bits (61), Expect = 4.0 Identities = 14/50 (28%), Positives = 30/50 (60%) Frame = +3 Query: 501 VYVSEPLIKSHSYLYPGGSADVLSVDSLFSVDQVSVMLTIWARIGRVRSL 650 + + E LI++ ++ G ADVLSVDSL S +++ ++ + ++ ++ Sbjct: 230 ISLEESLIRARAFTDAG--ADVLSVDSLVSREEMKAFCNVYPLVPKLANM 277 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,169,060 Number of Sequences: 28952 Number of extensions: 270997 Number of successful extensions: 557 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 557 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1545769616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -