BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20730 (478 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 81 3e-17 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 81 3e-17 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 81 3e-17 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 81 3e-17 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 26 0.78 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 4.1 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 23 5.5 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 5.5 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 7.2 EF426194-1|ABO26437.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426193-1|ABO26436.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426192-1|ABO26435.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426191-1|ABO26434.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426190-1|ABO26433.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426189-1|ABO26432.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426188-1|ABO26431.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426187-1|ABO26430.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426185-1|ABO26428.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426184-1|ABO26427.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426183-1|ABO26426.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426182-1|ABO26425.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426181-1|ABO26424.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426180-1|ABO26423.1| 133|Anopheles gambiae unknown protein. 22 9.6 EF426179-1|ABO26422.1| 133|Anopheles gambiae unknown protein. 22 9.6 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 22 9.6 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 22 9.6 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 80.6 bits (190), Expect = 3e-17 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 364 HYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGG 477 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTHSLGGG Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGG 38 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 80.6 bits (190), Expect = 3e-17 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 364 HYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGG 477 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTHSLGGG Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGG 38 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 80.6 bits (190), Expect = 3e-17 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 364 HYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGG 477 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTHSLGGG Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGG 38 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 80.6 bits (190), Expect = 3e-17 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 364 HYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGG 477 HYTEGAELVD+VLDVVRKE E+CDCLQGFQLTHSLGGG Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGG 38 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 25.8 bits (54), Expect = 0.78 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 53 MREIVHLQAGQCGNQIGAKFWE 118 MRE + + GQ G QIG W+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.4 bits (48), Expect = 4.1 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 325 FGQSGAGNNWAKGHYTEGAELVDSVLDVV 411 FG G + G YT +E +D VLD + Sbjct: 343 FGLEQCGTDGVPGVYTRMSEYMDWVLDTM 371 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 23.0 bits (47), Expect = 5.5 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 144 SMPCSSEMISQNLAPIWLPHWPACR*TIS 58 SM C + ++ I L W CR TIS Sbjct: 335 SMECFDALRKADIYAIGLIFWEVCRRTIS 363 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.0 bits (47), Expect = 5.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 107 KFWEIISDEHGIDPTG 154 KFW + D GI+ TG Sbjct: 225 KFWPTVCDYFGIESTG 240 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 22.6 bits (46), Expect = 7.2 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 320 KLSGRKICPKGPERTDSMVPGS 255 +LS K PKG E + MVP S Sbjct: 1036 RLSHSKSWPKGTENENYMVPPS 1057 >EF426194-1|ABO26437.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426193-1|ABO26436.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426192-1|ABO26435.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426191-1|ABO26434.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426190-1|ABO26433.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426189-1|ABO26432.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426188-1|ABO26431.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426187-1|ABO26430.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426185-1|ABO26428.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426184-1|ABO26427.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426183-1|ABO26426.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426182-1|ABO26425.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426181-1|ABO26424.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426180-1|ABO26423.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >EF426179-1|ABO26422.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = -1 Query: 370 CSVPWPSCC 344 C+ PW CC Sbjct: 66 CNTPWADCC 74 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 22.2 bits (45), Expect = 9.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 365 CPLAQLLPAPDCPKTKLSGRKICPKG 288 CPL ++ DC +L KI KG Sbjct: 207 CPLKPVITPEDCLAMELRRHKIHRKG 232 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 22.2 bits (45), Expect = 9.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 365 CPLAQLLPAPDCPKTKLSGRKICPKG 288 CPL ++ DC +L KI KG Sbjct: 208 CPLKPVITPEDCLAMELRRHKIHRKG 233 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 499,267 Number of Sequences: 2352 Number of extensions: 10067 Number of successful extensions: 41 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 42095889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -