BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20730 (478 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 24 0.96 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 2.2 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 9.0 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.8 bits (49), Expect = 0.96 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +1 Query: 388 VDSVLDVVRKESESCDCLQG 447 +DS+++++R ++CD L G Sbjct: 106 IDSIINIIRVRVDACDRLWG 125 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 22.6 bits (46), Expect = 2.2 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +2 Query: 167 DSDLQLERINVYYNEASGGKYVPRAILVDWSPAPWNLSAP 286 D+ L+ I Y N+ GG++V I W+P + + P Sbjct: 72 DARLKFSNIAPYLNQIYGGQFVRDLI---WTPTVYVSNEP 108 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 20.6 bits (41), Expect = 9.0 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -2 Query: 339 AGLSEDEVVRTEDLSE 292 AGL+E+EVV + ++E Sbjct: 62 AGLTEEEVVLAKTIAE 77 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,827 Number of Sequences: 438 Number of extensions: 2344 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12928545 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -