BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20728 (699 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0711 - 5324079-5324141,5324900-5324962,5325329-5325642,532... 42 6e-04 02_04_0622 - 24508508-24508666,24509533-24509634,24510108-245101... 34 0.12 08_01_0461 - 4063614-4064375,4064439-4066017,4066041-4066086,406... 29 3.5 01_01_1211 + 9753518-9753894,9754265-9754313,9754747-9754773 28 6.2 11_01_0779 + 6518556-6518601,6519825-6519967,6520091-6520114,652... 28 8.2 >02_01_0711 - 5324079-5324141,5324900-5324962,5325329-5325642, 5326076-5326245,5326347-5326431,5326775-5327015 Length = 311 Score = 41.5 bits (93), Expect = 6e-04 Identities = 23/57 (40%), Positives = 35/57 (61%) Frame = +3 Query: 519 WRRRNLMVKPLLKEAGIGGIILENPFYGLRKPIDQIRSSLHNVSDIFVMGGCLILES 689 + RR + PLLK+ I ++LE+P+YG R+P Q S L VSD+ ++G I E+ Sbjct: 87 FERRLRLGGPLLKD-NIATMVLESPYYGQRRPSMQHGSKLQCVSDLLLLGKATIDEA 142 >02_04_0622 - 24508508-24508666,24509533-24509634,24510108-24510176, 24510294-24510362,24510428-24510502,24510584-24510688, 24511309-24511407,24511521-24513230,24513489-24513788, 24514748-24514846,24514962-24515079,24515166-24515251, 24515334-24515402,24515746-24515843,24516373-24516534, 24516779-24516787,24516970-24516991,24517620-24517712, 24517872-24517940,24518720-24518782,24518882-24519037, 24520895-24521230 Length = 1355 Score = 33.9 bits (74), Expect = 0.12 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +2 Query: 203 KFFTKGWGKPENLRRLFGS--EKLYRIVKNASNWLKETIPSPLLRNK 337 + FTK W PE RRLF S + RI+ + L++ PSP LR K Sbjct: 437 RMFTKTW--PERSRRLFMSFDPAVQRIINDEDGGLQKRYPSPSLREK 481 >08_01_0461 - 4063614-4064375,4064439-4066017,4066041-4066086, 4066416-4066933,4067435-4067694,4068089-4068594, 4068667-4071319 Length = 2107 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = -1 Query: 237 FSGLPQPFVKNFVNRILRYTASNLLADILYVILIENKIVFKLKL 106 FSG +PF ++ +NRILR SN L D L + + ++F L L Sbjct: 389 FSGDYEPFSRDVINRILRIIWSN-LEDPLSQTVKQVHLIFDLLL 431 >01_01_1211 + 9753518-9753894,9754265-9754313,9754747-9754773 Length = 150 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/32 (53%), Positives = 19/32 (59%) Frame = -2 Query: 419 AISGTIPGRCFSRGLVKYPSRSLPSATFCSLV 324 A SG+ GRCFSR + PS LP F SLV Sbjct: 94 AASGSSYGRCFSR--PQPPSMKLPVILFFSLV 123 >11_01_0779 + 6518556-6518601,6519825-6519967,6520091-6520114, 6520140-6520286,6521957-6522142,6522232-6522490, 6522738-6522969,6523081-6523231,6523322-6523499, 6523916-6524191,6524414-6524642,6524754-6524904, 6525013-6525192 Length = 733 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = +2 Query: 239 LRRLFGSEKLYRIVKNASNWLKETIPSPLLRNKMSPRASFLKDTSLVL 382 L RLFG E+ I +N W+ P R ++S ++ L+L Sbjct: 326 LSRLFGQEQTRLITQNVVGWIGYIAPEYYYRGEISEKSDIFSLGILIL 373 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,810,861 Number of Sequences: 37544 Number of extensions: 366022 Number of successful extensions: 873 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -